DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and SAMD7

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001291295.1 Gene:SAMD7 / 344658 HGNCID:25394 Length:446 Species:Homo sapiens


Alignment Length:455 Identity:92/455 - (20%)
Similarity:147/455 - (32%) Gaps:152/455 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1006 HITSPYIHPCGWHEGRQQLIVPPDYQKSAFIWDDYISEVGGMAASKELF----TPRQPME----Y 1062
            ::.|..|:| ||.      |:||:             .:..:|...|:.    |.|..||    |
Human    62 NVLSSRIYP-GWG------ILPPE-------------SIKAVARRNEMIQRHHTARTEMEMYAIY 106

  Fly  1063 QERMKLEVVDQRN------PCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCE 1121
            |:| ::|.::.:.      |.|...:.......|..:..|             .:.|||   :..
Human   107 QQR-RMEKINPKGLAGLGIPFLYGSSVPAAPAAYHGRSML-------------PAGDLH---FHR 154

  Fly  1122 ATSHELE-------TPPGYLQP--------------KSVMPCDVEGCRGFGNAKRFNLNVHALRE 1165
            :|...|:       |.|.:.:.              :..:..|.|..:.....|... ..||:  
Human   155 STLRNLQGNPMLAATAPHFEESWGQRCRRLRKNTGNQKALDSDAESSKSQAEEKILG-QTHAV-- 216

  Fly  1166 CCPY------------APENWRQWRSKTVKPPRVAPENI--------RRGWAKKTKRACSEAKQA 1210
              ||            ||.|  |..|:|.:.|..|..|.        |:.|...|....::|...
Human   217 --PYEEDHYAKDPDIEAPSN--QKSSETNEKPTTALANTCGELEPTHRKPWGSHTTTLKAKAWDD 277

  Fly  1211 IKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKDYGP 1275
            .||::.::|.              :.|:|          |......||               .|
Human   278 GKEEASEQIF--------------ATCDE----------KNGVCPPVP---------------RP 303

  Fly  1276 QFLPNYRLWQLNSAFKLD-DVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGR 1339
            .....:.|..:.....|| |::    .||..||..:|......:|.|:|..:..|||..|.:|..
Human   304 SLPGTHALVTIGGNLSLDEDIQ----KWTVDDVHSFIRSLPGCSDYAQVFKDHAIDGETLPLLTE 364

  Fly  1340 KELDTYLKLKVGPAVKLYSLILNLRIAVVCKFDSKNIELESNTAGPIQREMDTPVSAIKQLPEQS 1404
            :.|...:.||:|||:|:.|.:..   .|...|..|.:..      ||::..|.|......|...|
Human   365 EHLRGTMGLKLGPALKIQSQVSQ---HVGSMFYKKTLSF------PIRQAFDQPADTSPLLDPNS 420

  Fly  1405  1404
            Human   421  420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723 6/21 (29%)
MBT 1038..1130 CDD:214723 19/112 (17%)
SAM_PNT 1279..1366 CDD:280377 25/87 (29%)
SAMD7NP_001291295.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..207 2/19 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..277 13/53 (25%)
SAM_Samd7,11 324..391 CDD:188978 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.