DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and Samd7

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001178632.1 Gene:Samd7 / 310257 RGDID:1308931 Length:445 Species:Rattus norvegicus


Alignment Length:333 Identity:87/333 - (26%)
Similarity:133/333 - (39%) Gaps:61/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1130 PPGYLQPKSVMPC-DVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQ---WRSKTV--KPPRVA 1188
            |.|: |.:|.:|. ||...|......:.|..:.|.|   |:..|.|.|   .|..||  |||.:.
  Rat   140 PAGF-QGRSTLPASDVHVHRSTFRHLQGNPVLLATR---PHFTECWGQKYRLRRGTVYQKPPEID 200

  Fly  1189 PENIRRGWAKKTK----RACSEAKQAIKE-----DSQQEIVYPKVAE----VVQA---------K 1231
            .|:.:....:|:.    .|..|.::.||:     |:|||   |:|.:    .|.|         :
  Rat   201 TESFKSQADEKSSGQMPTAPYEEEEYIKDPEIGVDNQQE---PRVTDGNPTAVLANPHGEPQPNQ 262

  Fly  1232 RKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKDYG---PQFLPNYRLWQLNSAFKLD 1293
            ||.|..|.|.....|....|:..|...::..:.:..|.:...|   |..|...|        .|.
  Rat   263 RKPSSMEAKAWDDGKGEPSEQGYEGCDEKNGVCLPASTLPLPGTQEPVALQENR--------PLS 319

  Fly  1294 DVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYS 1358
            |:.    .||..||..:|......:|.|:|..:..|||..|.:|..:.|...:.||:|||:|:.|
  Rat   320 DIH----KWTVDDVYNFIRSLPGCSDYAQVFKDHAIDGETLPLLTEQHLRGTMGLKLGPALKIQS 380

  Fly  1359 LILNLRIAVVCKFDSKNIELESNTAGPIQREMDT-PVSAIKQLPEQSQTNGYKTDHDQELSESGD 1422
            .:......:.||   |...|.|:......:..|| |:.||     .|..:|......|::  ...
  Rat   381 QVSQHVGNMFCK---KLPSLPSHARQAFDQPADTSPLLAI-----GSWRDGLSIPGSQDI--MSP 435

  Fly  1423 DDDDEDVM 1430
            :..::|||
  Rat   436 ERAEQDVM 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723 87/333 (26%)
SAM_PNT 1279..1366 CDD:280377 24/86 (28%)
Samd7NP_001178632.1 SAM_Samd7,11 321..388 CDD:188978 21/70 (30%)
SAM 322..384 CDD:197735 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.