powered by:
Protein Alignment l(3)mbt and Scml4
DIOPT Version :9
Sequence 1: | NP_733209.1 |
Gene: | l(3)mbt / 43288 |
FlyBaseID: | FBgn0002441 |
Length: | 1477 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006256634.1 |
Gene: | Scml4 / 309859 |
RGDID: | 1310898 |
Length: | 414 |
Species: | Rattus norvegicus |
Alignment Length: | 73 |
Identity: | 26/73 - (35%) |
Similarity: | 40/73 - (54%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 1291 KLDDVR----TNPLHWTSWDVCEYIERALDSTDI---AKVIFEQDIDGRALLMLGRKELDTYLKL 1348
::.|.| .||..||..||..:::.| |...: .::..:.:|||.|||:|....:..||.|
Rat 331 EIQDTRRPSSRNPSTWTVEDVVRFVKDA-DPQALGPHVELFRKHEIDGNALLLLRSDMIMKYLGL 394
Fly 1349 KVGPAVKL 1356
|:|||:||
Rat 395 KLGPALKL 402
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166343706 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.