DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and Scml4

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001346193.1 Gene:Scml4 / 268297 MGIID:2446140 Length:490 Species:Mus musculus


Alignment Length:73 Identity:26/73 - (35%)
Similarity:40/73 - (54%) Gaps:8/73 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1291 KLDDVR----TNPLHWTSWDVCEYIERALDSTDI---AKVIFEQDIDGRALLMLGRKELDTYLKL 1348
            ::.|.|    .||..||..||..:::.| |...:   .::..:.:|||.|||:|....:..||.|
Mouse   407 EVQDTRRPSSRNPSTWTVEDVVRFVKDA-DPEALGPHVELFRKHEIDGNALLLLRSDMIMKYLGL 470

  Fly  1349 KVGPAVKL 1356
            |:|||:||
Mouse   471 KLGPALKL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377 26/73 (36%)
Scml4NP_001346193.1 RBR 83..142 CDD:319226
SLED 177..285 CDD:314933
SAM_Scm 416..487 CDD:188977 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839865
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.