DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and Samd11

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006538909.1 Gene:Samd11 / 231004 MGIID:2446220 Length:558 Species:Mus musculus


Alignment Length:512 Identity:102/512 - (19%)
Similarity:168/512 - (32%) Gaps:168/512 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 IPSTGPGAQVSLLANPLKPRAPLIL---SKVAVDKLRLKFSQVKSNPNALVL----GKANHVKKL 273
            |||  .|.:.:....||.|....:|   .:||...||        .|:.|.:    ..|:|.:|.
Mouse    93 IPS--HGIEPTYQGGPLSPPFSDLLRVRQEVATATLR--------GPSGLEVHLPSSTADHRRKQ 147

  Fly   274 LTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTA---------------MPIA-------TE 316
            .......|.....:|..:.::   .||..|:::|:.|               ||.|       :.
Mouse   148 GLVQRREGAVPAAATSFSERE---MSQPPPLLSPQNAAHITMSSHLRPPFLGMPTAVCQTPGFSF 209

  Fly   317 VPTADNNKMS----LIKSKPVA-------IKAVPLPSQEAPIVPAVAPVVTSPEKVD-------- 362
            :|:|....::    |::.:.:|       ::...|.|...|::||....:..||..|        
Mouse   210 LPSAQAEMLARQQELLRKQSLARLEMSELLRQKELGSVHRPLLPAPEVALHIPEGPDELQRRGSM 274

  Fly   363 --VKPTAKPSIKTAPKPTPKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPCGPKEL 425
              :|.::.|.:...|:..|.|      ||                             |..|||.
Mouse   275 LVLKHSSAPLLALPPQGPPGP------GP-----------------------------PIPPKES 304

  Fly   426 PKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIK 490
            .:.:..|..:...|:.|    :......:.|:||.  |:||.       :.|.|..|.....|..
Mouse   305 ARSRSEKGSLGVQPSQP----KETTGAGLWAQEVS--EEPSK-------DSDGEDPETAAAREGT 356

  Fly   491 KTPKQ----NQKPEKQEAPKKKQIPMPILPAGITISTTS----TAKKKAVRKNSSVTTISSSS-- 545
            .||.|    ..:.|.:.......:|.| ||.|......|    |.....:..:...||:...:  
Mouse   357 STPSQVPAGGTRAEGRGLLSGSTLPPP-LPLGFPCGAVSPYFHTGTMGGLFTDEETTTLEDVNKW 420

  Fly   546 ------------SDSSSYS--------DVEVVPTKKTEKELSMLPGISI-----IKAE------- 578
                        |....|:        |.|.:|. .||:.|....|:.:     |:|:       
Mouse   421 TVDDVCNFVGGLSGCGEYARVFGEQGIDGETLPL-LTEEHLLNTMGLKLGPALKIRAQVAKRLGR 484

  Fly   579 -----SLPLSREDFERSLRCDEQVPQTPPKSSSSSSS---GSHASEMSPPPKLADPK 627
                 |.|::......||:..|..|...|.|.::::|   |:|.     |...|.||
Mouse   485 VFYMASFPVALPLQPPSLQAPELSPGHQPLSPATTTSPYEGTHL-----PTGQASPK 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
Samd11XP_006538909.1 SAM_Samd7,11 417..484 CDD:188978 11/67 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.