DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and lin-61

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001122501.1 Gene:lin-61 / 172467 WormBaseID:WBGene00003041 Length:612 Species:Caenorhabditis elegans


Alignment Length:327 Identity:91/327 - (27%)
Similarity:143/327 - (43%) Gaps:48/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   845 ISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSF----------------DGYSSMYDF 893
            :|.:.|::|.:||.::..|.:...|..|.|:.|.|:.:|.                ..:||...:
 Worm   294 LSKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVFSSGSQY 358

  Fly   894 WVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPR-----ALFGHLNMQQQ 953
            |::..|..|||.|:.......|.|.|:| .|..:.....:|.|..  ||     ..|..| .:..
 Worm   359 WIDEGSFFIFPVGFAAVNGYQLNAK
KEY-IEHTNKIAQAIKNGEN--PRYDSDDVTFDQL-AKDP 419

  Fly   954 MD--VRNGFAVGMHLE-----AEDLNDTGKICVATVTDI--LDERIRVHFDGWDDCYDLW-VHIT 1008
            :|  :.....||...|     |:..|:   :.||::...  .:..:.|..||.|...|.: :||.
 Worm   420 IDPMIWRKVKVGQKFELIDPLAQQFNN---LHVASILKFCKTEGYLIVGMDGPDALEDSFPIHIN 481

  Fly  1009 SPYIHPCGWHEGRQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQER-------M 1066
            :.::.|.|:.|.....:||||..|..|.||:|:.:........:||   :||..|||       :
 Worm   482 NTFMFPVGYAEKYNLELVPPDEFKGTFRWDEYLEKESAETLPLDLF---KPMPSQERLDKFKVGL 543

  Fly  1067 KLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPP 1131
            :||..|......|.||||.:..|..:.::.|.|..|:....:.||.|:.|||||||.|:.|:.|.
 Worm   544 RLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPK 608

  Fly  1132 GY 1133
            .|
 Worm   609 KY 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 21/88 (24%)
MBT 929..1028 CDD:214723 25/113 (22%)
MBT 1038..1130 CDD:214723 33/98 (34%)
SAM_PNT 1279..1366 CDD:280377
lin-61NP_001122501.1 MBT 146..248 CDD:214723
MBT 283..383 CDD:214723 21/88 (24%)
MBT 433..505 CDD:280910 19/74 (26%)
MBT 511..607 CDD:214723 33/98 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.