DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and SAMD13

DIOPT Version :10

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_016855866.1 Gene:SAMD13 / 148418 HGNCID:24582 Length:122 Species:Homo sapiens


Alignment Length:60 Identity:24/60 - (40%)
Similarity:38/60 - (63%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1298 NPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLY 1357
            :|..|...||..|. |.:...:.|....||:|||::||::.|.::.|.|:||:|||:|:|
Human    47 DPADWAVMDVVNYF-RTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 PRK10819 <332..>427 CDD:236768
MBT_L3MBTL1-like_rpt1 846..945 CDD:439091
MBT_L3MBTL1-like_rpt2 957..1045 CDD:439092
MBT_L3MBTL1-like_rpt3 1058..1130 CDD:439093
SAM_PNT 1278..1367 CDD:460486 24/60 (40%)
SAMD13XP_016855866.1 SAM_Atherin-like 48..116 CDD:188982 24/59 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.