DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14260 and AT4G08455

DIOPT Version :9

Sequence 1:NP_651551.1 Gene:CG14260 / 43287 FlyBaseID:FBgn0039504 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_680660.3 Gene:AT4G08455 / 826404 AraportID:AT4G08455 Length:270 Species:Arabidopsis thaliana


Alignment Length:146 Identity:34/146 - (23%)
Similarity:70/146 - (47%) Gaps:14/146 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 HQVMLISASAEFERLIRDPEFQKNKRVISVDDASPTAYEALLLYIYTYEVCNAVTIDMCGDLMLL 106
            |:.:|:|.|..|:.::.:...:.....|.:.|.|..|....:.|:||.|.|  :...|..||:::
plant   110 HKSVLVSRSPVFKAMLENEMEESLSGTIKISDVSYDALRTFVYYLYTAEAC--LDEQMACDLLVM 172

  Fly   107 AERYEMLDFIDCYIDKLAHQEWPMEVVLQVFHLASEHHHPALMDLVAKKILPVATQVLMDNSFLK 171
            :|:|: :..:..|.::....:...:..|..:..|.:|:        ||.:|..|...:::| ..|
plant   173 SEKYQ-VKHLKSYCERFLVTKLSPDNSLMTYAFAHQHN--------AKHVLDAALSQIVEN-MDK 227

  Fly   172 LSVKELKALMIILKKD 187
            |:.:|  ..|.:::||
plant   228 LTKRE--EYMELVEKD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14260NP_651551.1 BTB 9..117 CDD:295341 19/74 (26%)
BTB 38..127 CDD:197585 20/84 (24%)
AT4G08455NP_680660.3 BTB_POZ_ZBTB_KLHL-like 90..176 CDD:349497 18/67 (27%)
BACK 194..248 CDD:350515 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.