DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14260 and CG14262

DIOPT Version :9

Sequence 1:NP_651551.1 Gene:CG14260 / 43287 FlyBaseID:FBgn0039504 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_651550.1 Gene:CG14262 / 43286 FlyBaseID:FBgn0039503 Length:312 Species:Drosophila melanogaster


Alignment Length:248 Identity:71/248 - (28%)
Similarity:126/248 - (50%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRLDLLRNGQKSDCELHVSQPDKLKEGKRCP---------CI--FRCHQVMLISASAEFERLIRD 59
            |||:..|:|..:||::||.        ..||         |.  |.||::.|.:||.:.|:    
  Fly    76 RRLEYFRSGADADCQVHVL--------SNCPQSDEPAVSVCYKKFGCHRIFLATASDKLEQ---- 128

  Fly    60 PEFQKNK---RVISVDDASPTAYEALLLYIYTYEVCN-AVTIDMCGDLMLLAERYEMLDFIDCYI 120
             :..:||   .|:.::..||.:.|..|.:|||:||.: .|.:.:.||:.:|:..|.|.:.:..:.
  Fly   129 -DVYQNKDWNGVLQINGVSPESVEIFLEFIYTFEVTSPLVQLKLVGDMFILSCAYNMPELLRSFA 192

  Fly   121 DKLAHQEWPMEVVLQVFHLASEHHHPALMDLVAKKILPVATQVLMDNSFLKLSVKELK-ALMIIL 184
            :||..||.|::.:...|.||..|:...:..:..:||:.....::.:.|.:||.|..|. |:...|
  Fly   193 EKLKEQELPLDGIFPAFDLAFRHNIIDVERVCIEKIIEEGASLIHEPSLMKLPVYALNYAIQHWL 257

  Fly   185 KKDGDLSDHELLTSLKNYQDVNNLRYEDMEQFQQLVEVTQLFGHVLFEVDGTI 237
            ..|....| ||:|.||.||::|.:.:.:.::|....::.:.|.:||.:.:|.|
  Fly   258 VADAVPPD-ELITILKQYQEINEITFANTQKFPHFTKIIKYFPNVLLDAEGFI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14260NP_651551.1 BTB 9..117 CDD:295341 34/122 (28%)
BTB 38..127 CDD:197585 27/94 (29%)
CG14262NP_651550.1 BTB 110..199 CDD:197585 27/93 (29%)
BTB 110..196 CDD:295341 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5X1
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I7679
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019757
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.