DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14260 and hpo-9

DIOPT Version :9

Sequence 1:NP_651551.1 Gene:CG14260 / 43287 FlyBaseID:FBgn0039504 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_504839.1 Gene:hpo-9 / 179117 WormBaseID:WBGene00015463 Length:581 Species:Caenorhabditis elegans


Alignment Length:222 Identity:49/222 - (22%)
Similarity:103/222 - (46%) Gaps:15/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FRCHQVMLISASAEFERLIRDPEFQKNKRVISVDDASPTAYEALLLYIYTYEVCNA-VTIDMCGD 102
            |..|:::|...|:.|..::.....:.:::::::.:.:..|:.|:|.|:||.::..| |.:|:..:
 Worm    76 FAAHRLILAVRSSFFRAMLYTGFQESHQQLVTLQETNSVAFRAVLRYMYTSKIDFAGVELDILLE 140

  Fly   103 LMLLAERYEMLDFIDCYIDKLAHQEWPMEVVLQVFHLASEHHHPALMDLVAKKILPVATQVLMDN 167
            .:.||.||:::..:.. |.:...:....|.:..:|:.|.......|:|...:.....|.|:|.|.
 Worm   141 YLSLAHRYDLIQLMTA-ISEYFKEILKNENLCSIFNAAYFFQFTDLIDYCMQYSDKHADQLLEDP 204

  Fly   168 SFLKLSVKELKALMIILKKDGDLS-DHELLTSLKNYQDVNNLRYEDMEQFQQLVEV-----TQLF 226
            ||.:||...||.|   |.:|...: :.::..:::::...|....|..:...:||.:     |:|.
 Worm   205 SFNRLSGDSLKEL---LARDSFFALELKIFNAVRSWHQNNPTMKEASKVLLELVRLPLITQTELL 266

  Fly   227 GHV----LFEVDGTIVVPEEEKPSPEE 249
            ..|    |...|..:...|.:...|.|
 Worm   267 NCVRPTGLVSADTLLDAIEVQTQRPHE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14260NP_651551.1 BTB 9..117 CDD:295341 18/78 (23%)
BTB 38..127 CDD:197585 19/88 (22%)
hpo-9NP_504839.1 BTB_POZ_BTBD9 42..161 CDD:349596 19/85 (22%)
BACK_BTBD9 165..265 CDD:350518 23/102 (23%)
F5_F8_type_C 461..557 CDD:366285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.