DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14262 and Klhl40

DIOPT Version :10

Sequence 1:NP_651550.1 Gene:CG14262 / 43286 FlyBaseID:FBgn0039503 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001101665.2 Gene:Klhl40 / 316088 RGDID:1305368 Length:621 Species:Rattus norvegicus


Alignment Length:124 Identity:33/124 - (26%)
Similarity:53/124 - (42%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VSVCYKKFGCHRIFLATASDKLEQDVYQNKDWNGVLQINGVSPESVEIFLEFIYTFEVTSPLVQL 169
            |.|..::|.|||:.||..|...........|..|.|::..|||:.|...|.::||.|:.   :..
  Rat    37 VRVGEREFPCHRLVLAACSPYFRARFLAEPDGAGELRLEEVSPDVVSQVLHYLYTSEIA---LDE 98

  Fly   170 KLVGDMFILSCAYNMPELLR---SFAEKLKEQELPLDGIFPAFDLAFRHNIIDVERVCI 225
            ..|.|:|..:..:.:|.:..   ||.:|    .|.|......|.|..   ::|..|:.:
  Rat    99 ASVQDLFAAAHRFQIPSIFTICVSFLQK----RLCLANCLAVFRLGL---LLDCARLAV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14262NP_651550.1 BTB_POZ_ZBTB_KLHL-like 105..182 CDD:349497 23/76 (30%)
Klhl40NP_001101665.2 BTB_POZ 6..137 CDD:453885 29/106 (27%)
PHA03098 47..594 CDD:222983 29/114 (25%)
KELCH repeat 351..398 CDD:276965
KELCH repeat 402..448 CDD:276965
KELCH repeat 452..497 CDD:276965
KELCH repeat 500..545 CDD:276965
KELCH repeat 547..594 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.