DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-L and Ston1

DIOPT Version :9

Sequence 1:NP_476995.1 Gene:TfIIA-L / 43284 FlyBaseID:FBgn0011289 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_084134.2 Gene:Ston1 / 77057 MGIID:1924307 Length:730 Species:Mus musculus


Alignment Length:288 Identity:60/288 - (20%)
Similarity:95/288 - (32%) Gaps:84/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NGLVPIKQEVNSQNPPPLHPTSAASMMQKQQQA---ASSGQGSIPIVATLDPNRIMP-------- 178
            |||   |..:.:...||..|:||:|........   .|.|..|...::|  |.:..|        
Mouse    38 NGL---KLTLPTLRDPPSTPSSASSTPLSSPMVDFYFSPGPPSNSPLST--PTKDFPGFPGIPKA 97

  Fly   179 -VNITLPSPAGSASSESRVLTIQVPASA------LQENQLTQILTAHLISSIMSLPTTLASSVLQ 236
             .::..|.|..|:||        .|.:|      |       :||....|..:|||::      .
Mouse    98 GTHVLYPIPECSSSS--------APTTAGGVGPPL-------LLTKPDCSPHVSLPSS------H 141

  Fly   237 QHVNAA-----LSSANHQKTLAAAKQLDGALDSSD------EDESEESDDNIDN--DDDDDLDKD 288
            .|....     ...|..|:..:.|:|.:...|...      :||...|...:|:  .......||
Mouse   142 SHTQPTPTLGFTEDAGPQRVQSEARQFEYFQDHCAFSNPFWKDEGSASPFPLDSLASRKPFSPKD 206

  Fly   289 DD-----------------EDAEHEDAAEEEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKI-TRS 335
            .:                 |..||..:||     ::|.:.|....:.:..|.|....:... ::.
Mouse   207 KEVPIGHKSLTQCSLDYICEKLEHLHSAE-----TQDPLGDLSMQDPYAGDTVSFVPHSLFRSQP 266

  Fly   336 RNKWKFYL----KDGIMNMRGKDYVFQK 359
            |..|.|.|    |..:|:.|....:|.|
Mouse   267 RAGWSFMLRIPEKKNMMSSRQWGPIFLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-LNP_476995.1 TFIIA_alpha_beta_like 8..>62 CDD:199899
TFIIA 11..366 CDD:281188 60/288 (21%)
TFIIA_alpha_beta_like <306..366 CDD:199899 13/59 (22%)
Ston1NP_084134.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..83 13/47 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..159 6/32 (19%)
AP_MHD_Cterm 397..711 CDD:385861
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.