DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIA-L and stnB

DIOPT Version :9

Sequence 1:NP_476995.1 Gene:TfIIA-L / 43284 FlyBaseID:FBgn0011289 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:377 Identity:73/377 - (19%)
Similarity:121/377 - (32%) Gaps:132/377 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PPPIVANNP-------------------KSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGL 111
            |||:.|.||                   |..|....|:|:...:.....|..:...:|...|  |
  Fly   260 PPPLAAVNPPPAAPEADDLLDMFGTTACKPAKPPPPKSKEDILSLFEQPHVPLSQPASKPDL--L 322

  Fly   112 KSSAGMAAGSGIRNGLVPIKQ---------EVNSQNPPP-----LHPTSAASMMQKQQQAASSGQ 162
            ........|.|     .|.:|         |::|::.|.     :.|..:...:..|.|||:..:
  Fly   323 HDDLDETIGEG-----EPPEQEEPDTEQSNEISSRDEPVFTSLLIRPDESTHDITSQPQAATGLE 382

  Fly   163 GSIPIVATLDPNRIMPVNITLPSPAGSASSES------RVLTIQ-VPAS-------ALQENQL-- 211
            ..:..:|               :|:|:||::.      .:.|:: :|.|       |:||.:.  
  Fly   383 RQVNNMA---------------APSGTASTQRATTPDIEITTVEDLPRSDDEDEPEAMQEPETET 432

  Fly   212 ---------TQILTAHLISSIMSLPTTLASSVLQQHVNAALSSANHQKTLAAAKQLDGALDSSDE 267
                     .:|::.|      |.||                    ::.:..|..:||.|.:: |
  Fly   433 KPQIEPDTEPEIVSEH------SPPT--------------------ERLVTQAALVDGELIAA-E 470

  Fly   268 DESEESDDNIDND--DDDDLDKDDDEDAEHEDAAEEEP--------------LNSEDDVTDEDSA 316
            .|.||.|..:|..  ....|..:.....:     ||||              :|..|...:...|
  Fly   471 PEPEEMDTGLDFPLASSGQLSANPFASPD-----EEEPNFAPMPAAVANIFAVNDPDSQMETPKA 530

  Fly   317 EMFDTDNVIVCQYDKITRSRNKWKFYLKD--GIMNMRGKDYVFQKSNGDAEW 366
            .. .|.|:.....|:......|:....||  .||:..|.......:.||| |
  Fly   531 PS-HTANIFASDPDEFDAFSAKFDSVKKDNISIMDGFGGSGAITPTGGDA-W 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIA-LNP_476995.1 TFIIA_alpha_beta_like 8..>62 CDD:199899
TFIIA 11..366 CDD:281188 72/375 (19%)
TFIIA_alpha_beta_like <306..366 CDD:199899 14/61 (23%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603 29/160 (18%)
AP_MHD_Cterm 897..1219 CDD:299401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1533
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.