DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and RIPK2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_003812.1 Gene:RIPK2 / 8767 HGNCID:10020 Length:540 Species:Homo sapiens


Alignment Length:289 Identity:84/289 - (29%)
Similarity:128/289 - (44%) Gaps:30/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LGQGGFGDVYRGK---WKQLDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGY 280
            |.:|..|.|...:   |: :.||:|.::..:|.:|.   |.:....|.:.|:..|...||.:.|.
Human    24 LSRGASGTVSSARHADWR-VQVAVKHLHIHTPLLDS---ERKDVLREAEILHKARFSYILPILGI 84

  Fly   281 SIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHG 345
            ..:.....:|.:.|..|||...|  |: :...|.:.|..||.|....|.|:.:||... .||:|.
Human    85 CNEPEFLGIVTEYMPNGSLNELL--HR-KTEYPDVAWPLRFRILHEIALGVNYLHNMT-PPLLHH 145

  Fly   346 DIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKV--FGTKIYLPPEFRNFR-----QLST 403
            |:|..|||||.....||.||||.:....||.........  .||.||:|||  |:.     :.|.
Human   146 DLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPE--NYEPGQKSRASI 208

  Fly   404 GVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCM 468
            ..|:||:.::..||.:.:|..:.|      .|.|..:....:.:|..:.|:.|...:.....| :
Human   209 KHDIYSYAVITWEVLSRKQPFEDV------TNPLQIMYSVSQGHRPVINEESLPYDIPHRARM-I 266

  Fly   469 CAIEAGLHCTALDPQDRPSMNAVLKRFEP 497
            ..||:|   .|.:|.:|||....|...||
Human   267 SLIESG---WAQNPDERPSFLKCLIELEP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 84/289 (29%)
TyrKc 219..495 CDD:197581 82/285 (29%)
RIPK2NP_003812.1 STKc_RIP2 20..303 CDD:270928 84/289 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..369
CARD_RIP2_CARD3 438..524 CDD:176764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.