DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and ALK2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_009544.1 Gene:ALK2 / 852274 SGDID:S000000105 Length:676 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:47/263 - (17%)
Similarity:90/263 - (34%) Gaps:89/263 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QVEQISSQKQRGRSASNEFL-------------------NIWGGQYNHTVQTLFALFKKLKLHNA 113
            :|.:|:|.|......|..|.                   :.:.|:.:.|..:|..||.|:.    
Yeast    46 KVYKITSHKGSAEDESQSFFTSSDSPTSKTRPVGKTIENDDYYGKRSSTGSSLKQLFNKIN---- 106

  Fly   114 MRLIKDYVSEDLHKYIPRSVPTISEL-----RAAPDSSAKVNNG----PPFPSSSGVSNSNNNRT 169
               |.|.......:.:.:||.:.::|     |.:.....||.|.    |..|.|        |::
Yeast   107 ---INDTAHSSNKENVSQSVLSENKLLSPSKRLSKQGLTKVTNSKFRTPLRPIS--------NQS 160

  Fly   170 STTATEEIPSLESL-----------------GNIHISTVQRAAESLLEIDYAELENATDGWSPDN 217
            :.:..|.:....||                 .::|.|:|                |:.:.::...
Yeast   161 TLSRDEPVKDFRSLKFRSGSDFKCWGDEKTSSHVHSSSV----------------NSVNSFTSTT 209

  Fly   218 RLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSI 282
            ...:..|       ||..::..:.::.||.| ||     ..::.:.|..||::..:.::.:..||
Yeast   210 SSSKWKF-------WKNDNLLSRSLSSRSVN-DQ-----DPNFVQPKPTNSLQKKSSISSFHNSI 261

  Fly   283 KGG 285
            .||
Yeast   262 FGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 14/78 (18%)
STKc_IRAK 219..498 CDD:270968 15/67 (22%)
TyrKc 219..495 CDD:197581 15/67 (22%)
ALK2NP_009544.1 ALK1 136..672 CDD:227404 29/166 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24419
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.