DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and SRF5

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_178019.2 Gene:SRF5 / 844238 AraportID:AT1G78980 Length:699 Species:Arabidopsis thaliana


Alignment Length:617 Identity:151/617 - (24%)
Similarity:229/617 - (37%) Gaps:204/617 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AQNQANGNRTRSRSHLDNTMAIRL------LPLPVRAQLCAHLDALDV------------WQQLA 59
            ::|:.:||...|.|.:.|..:|.|      ..||...|..:.|:.||.            :..|.
plant   122 SENELDGNVPYSLSQMKNLQSINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLT 186

  Fly    60 TAVKLY--------------------------------PDQVEQISSQKQRGRSASNEFLNIW-- 90
            :..||:                                |::::.|.|....|        |.|  
plant   187 SLKKLHLQDNRFTGDINVLRNLAIDDLNVEDNQFEGWIPNELKDIDSLLTGG--------NDWST 243

  Fly    91 --------GGQYNH----------------------------TVQTLFALFKKLKLHNAMRLIKD 119
                    |.:|..                            .:..|.||..|.|    ..|...
plant   244 ETAPPPPPGVKYGRKSSGSKDGGGITAGTGMVIAGACLGVLVLIIVLIALVSKKK----SSLSPH 304

  Fly   120 YVSEDLHKYIPR-----SVPTISELRAAPDSSAKVNNGPPFPS---------SSGVSNSNNNRT- 169
            ::.||...:.|:     |..:..|||.  |......:|....|         |.|:.:..::|. 
plant   305 FIDEDNSHHTPKFKSLTSHGSAQELRV--DFGNDYKDGKSGDSGDENIHRIGSKGLKHYVSSRVM 367

  Fly   170 STTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ 234
            |.|.||....|    |...:|..|:|   :|.:.::|::||..:||.|.||:|..|.|||.|:..
plant   368 SFTDTEFANKL----NAKRTTSTRSA---VEFELSDLQSATANFSPGNLLGEGSIGRVYRAKYSD 425

  Fly   235 -LDVAIKVMNYRSPNIDQKMVELQQSYN---ELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMK 295
             ..:|:|       .||..:.:..:|..   .:..|:.|||.||..|.||..:.|...|||:..:
plant   426 GRTLAVK-------KIDSTLFDSGKSEGITPIVMSLSKIRHQNIAELVGYCSEQGHNMLVYEYFR 483

  Fly   296 GGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQP 360
            .|||...|  |.:......|||..|..|:|||||.:.:||.|....::|.:||.:|||||..|.|
plant   484 NGSLHEFL--HLSDCFSKPLTWNTRVRIALGTARAVEYLHEACSPSVMHKNIKSSNILLDADLNP 546

  Fly   361 KIGDFGLVREGPKSLDAVVEVNKVFGTKIYL-----------PPEFRNFRQLSTGVDVYSFGIVL 414
            ::.|:||                   :|.||           .||.|:....:...||||||:|:
plant   547 RLSDYGL-------------------SKFYLRTSQNLGEGYNAPEARDPSAYTPKSDVYSFGVVM 592

  Fly   415 LEVFTGRQVTD-RVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLH-- 476
            ||:.|||...| ..|..|  ::|:     :|            |.|...::|......:..||  
plant   593 LELLTGRVPFDGEKPRPE--RSLV-----RW------------ATPQLHDIDALSNIADPALHGL 638

  Fly   477 ---------------CTALDPQDRPSMNAVLK 493
                           |..::|:.||.|:.|::
plant   639 YPPKSLSRFADIIALCVQVEPEFRPPMSEVVE 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 27/183 (15%)
STKc_IRAK 219..498 CDD:270968 91/308 (30%)
TyrKc 219..495 CDD:197581 91/308 (30%)
SRF5NP_178019.2 LRRNT_2 25..65 CDD:369783
leucine-rich repeat 70..93 CDD:275380
PLN00113 <73..680 CDD:215061 151/617 (24%)
leucine-rich repeat 94..115 CDD:275380
leucine-rich repeat 116..139 CDD:275380 5/16 (31%)
leucine-rich repeat 140..163 CDD:275380 5/22 (23%)
leucine-rich repeat 164..187 CDD:275380 4/22 (18%)
leucine-rich repeat 188..209 CDD:275380 2/20 (10%)
leucine-rich repeat 210..230 CDD:275380 1/19 (5%)
PKc_like 410..675 CDD:389743 91/308 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.