DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G76370

DIOPT Version :10

Sequence 1:NP_476971.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177763.1 Gene:AT1G76370 / 843969 AraportID:AT1G76370 Length:381 Species:Arabidopsis thaliana


Alignment Length:65 Identity:15/65 - (23%)
Similarity:28/65 - (43%) Gaps:9/65 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 YDEYKFTLPALYREVAKEELREDDLVLVKALTEMRHWIAENPYIFKCRTDAK---FLLRFLRFRQ 78
            :..::|...|.|.....::.|:.. .|...:|:| .|:...    :|||..|   .|:..|.::|
plant    28 FTRFEFLFSADYGHYKTQQWRKKK-CLDNDVTDM-IWLRAP----RCRTGQKETDMLMCKLEYKQ 86

  Fly    79  78
            plant    87  86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_476971.1 Death_Pelle 32..128 CDD:260021 12/50 (24%)
STKc_IRAK 219..498 CDD:270968
AT1G76370NP_177763.1 STKc_IRAK 81..345 CDD:270968 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.