DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G76360

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177762.3 Gene:AT1G76360 / 843968 AraportID:AT1G76360 Length:484 Species:Arabidopsis thaliana


Alignment Length:429 Identity:125/429 - (29%)
Similarity:189/429 - (44%) Gaps:99/429 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 HKYIPRSVPTISELRAAPD--SSAKVNNGP---PFPSSSGVSN------SNNNRTSTTATEE--- 176
            ||..|.:.|.    |..|.  ::..|.|.|   |...:..|.|      ....|:..|..:|   
plant    57 HKLRPAATPP----REKPQHRTTRSVENPPREKPQEKTRSVENPPREKPQEKTRSVETPPQEKTR 117

  Fly   177 ----IPS--LESLG---------------NIHISTVQRAAESLLEIDYAELENATDGWSPDNRLG 220
                .||  :|.||               |:.:.|:            .||:.||..:.|::.:|
plant   118 PVDNPPSKPVEKLGLGRKAVPPSGKIVTPNLKMFTL------------VELKTATKNFRPESVIG 170

  Fly   221 QGGFGDVYRGKWKQ------------LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDN 273
            :||||.|::| |..            :.||:|..|   |:.:|.:.|.|   .|:::|....|.|
plant   171 EGGFGQVFKG-WVDEKTLAPSRAGVGIPVAVKKSN---PDSEQGLHEWQ---CEVRFLGKFHHPN 228

  Fly   274 ILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTAR 338
            ::.|.||..:..:..|||:.:..||||..|.:..|:    ||.|..|..|::..|:|:.|||.:.
plant   229 LVKLLGYCWEENQFLLVYEYLPKGSLENHLFSKGAE----ALPWDTRLKIAIEAAQGLTFLHNSE 289

  Fly   339 GTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEV-NKVFGTKIYLPPEFRNFRQLS 402
            .: :|:.|.|.:|||||.....|:.||||.:.||  ::....| .:|.||:.|..||:.....|.
plant   290 KS-VIYRDFKASNILLDSNFHAKLSDFGLAKNGP--INGFSHVTTRVMGTQGYAAPEYMATGHLY 351

  Fly   403 TGVDVYSFGIVLLEVFTGRQVTDRVPEN-ETKKNLLDYVK---------QQWRQNRMELLEKHLA 457
            ...|||.||:||||:.||.:..|  |.. ..::||:::.|         |:....|:|.....||
plant   352 VRSDVYGFGVVLLELLTGLRALD--PNRPSAQQNLVEWAKPGLNQKKKVQKMMDPRLEQKYPLLA 414

  Fly   458 APMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            .....||.         |.|...||::||.|:.||:..|
plant   415 VTKTAELI---------LRCLEADPKNRPPMDDVLRELE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 1/1 (100%)
STKc_IRAK 219..498 CDD:270968 98/301 (33%)
TyrKc 219..495 CDD:197581 97/298 (33%)
AT1G76360NP_177762.3 Streccoc_I_II <25..>140 CDD:411384 20/86 (23%)
STKc_IRAK 169..444 CDD:270968 97/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.