DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G70740

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001185366.1 Gene:AT1G70740 / 843411 AraportID:AT1G70740 Length:425 Species:Arabidopsis thaliana


Alignment Length:356 Identity:114/356 - (32%)
Similarity:174/356 - (48%) Gaps:59/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNR 218
            ||..||       ||......|.|.::|          |:.      ..:..|.:||..:.|.::
plant    14 PFKRSS-------NRGLEDDIERIAAME----------QKV------FPFQVLVSATKDFHPTHK 55

  Fly   219 LGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSI 282
            ||:||||.|::|:... .|:|:|.::..|.....:.|      ||.|.|..::|.|::.|:||..
plant    56 LGEGGFGPVFKGRLPDGRDIAVKKLSQVSRQGKNEFV------NEAKLLAKVQHRNVVNLWGYCT 114

  Fly   283 KGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDI 347
            .|....|||:.:...||:..|   ...|....:.|:|||.|..|.|||:.:||......:||.||
plant   115 HGDDKLLVYEYVVNESLDKVL---FKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDI 176

  Fly   348 KPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLPPEFRNFRQLSTGVDVYSFG 411
            |..|||||:...|||.|||:.|   ...:.|..|| :|.||..|:.||:.....||...||:|||
plant   177 KAGNILLDEKWVPKIADFGMAR---LYQEDVTHVNTRVAGTNGYMAPEYVMHGVLSVKADVFSFG 238

  Fly   412 IVLLEVFTGRQVTD---RVPENETKKNLLDYVK------------QQWRQNR-MELLEKHLAAPM 460
            :::||:.:|::.:.   |.|:    :.||::||            :.:::.| ||:|::.:||  
plant   239 VLVLELVSGQKNSSFSMRHPD----QTLLEWVKPLVSCSIVYRAFKLYKKGRTMEILDQDIAA-- 297

  Fly   461 GKELDMCMCAIEAGLHCTALDPQDRPSMNAV 491
            ..:.|.....::.||.|...||..||||..|
plant   298 SADPDQVKLCVQIGLLCVQGDPHQRPSMRRV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 100/291 (34%)
TyrKc 219..495 CDD:197581 100/291 (34%)
AT1G70740NP_001185366.1 STYKc 54..332 CDD:214568 100/293 (34%)
STKc_IRAK 56..328 CDD:270968 99/289 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.