DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and CRK3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177210.1 Gene:CRK3 / 843390 AraportID:AT1G70530 Length:646 Species:Arabidopsis thaliana


Alignment Length:340 Identity:105/340 - (30%)
Similarity:166/340 - (48%) Gaps:30/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQ 221
            |::|......:.......:::.||..|.|          :|.|...|..||.|||.:|..|:|||
plant   277 SAAGFLLKKRHAKKQREKKQLGSLFMLAN----------KSNLCFSYENLERATDYFSDKNKLGQ 331

  Fly   222 GGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGG 285
            ||.|.||:|.... ..||:|.:.:.:    ::.|:  ..:||:..::.:.|.|::.|.|.||.|.
plant   332 GGSGSVYKGVLTNGKTVAVKRLFFNT----KQWVD--HFFNEVNLISQVDHKNLVKLLGCSITGP 390

  Fly   286 KPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPA 350
            :..|||:.:...||...|...|...|   |.|.:||.|.||||.|:.:||......:||.|||.:
plant   391 ESLLVYEYIANQSLHDYLFVRKDVQP---LNWAKRFKIILGTAEGMAYLHEESNLRIIHRDIKLS 452

  Fly   351 NILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLL 415
            ||||:....|:|.||||.|..|:  |.......:.||..|:.||:....:|:...||||||::::
plant   453 NILLEDDFTPRIADFGLARLFPE--DKTHISTAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMI 515

  Fly   416 EVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCA--IEAGLHCT 478
            ||.||::      .|...::....::..|...|...:|:.:...:|...:....:  ::.||.|.
plant   516 EVITGKR------NNAFVQDAGSILQSVWSLYRTSNVEEAVDPILGDNFNKIEASRLLQIGLLCV 574

  Fly   479 ALDPQDRPSMNAVLK 493
            ......||:|:.|:|
plant   575 QAAFDQRPAMSVVVK 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 89/278 (32%)
TyrKc 219..495 CDD:197581 89/278 (32%)
CRK3NP_177210.1 Stress-antifung 30..127 CDD:396296
Stress-antifung 157..237 CDD:396296
STKc_IRAK 329..593 CDD:270968 89/278 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.