DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G70110

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177168.1 Gene:AT1G70110 / 843347 AraportID:AT1G70110 Length:666 Species:Arabidopsis thaliana


Alignment Length:297 Identity:98/297 - (32%)
Similarity:157/297 - (52%) Gaps:24/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YAELENATDGWSPDNRLGQGGFGDVYRGKW--KQLDVAIKVMNYRSPNIDQKMVELQQSYNELKY 265
            :.:|..||.|:.....||:||||.||:|..  ..:::|:|::::.|..      .:::...|:..
plant   334 FKDLHIATKGFKDTEVLGKGGFGKVYKGTLPVSNVEIAVKMVSHDSRQ------GMREFIAEIAT 392

  Fly   266 LNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARG 330
            :..:||.|::.|.||....|:..|||..|..|||:..|...:..|    |.|.|||.|....|.|
plant   393 IGRLRHPNLVRLQGYCRHKGELYLVYDCMAKGSLDKFLYHQQTGN----LDWSQRFKIIKDVASG 453

  Fly   331 IYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEF 395
            :|:||......:||.||||||||||..:..|:|||||.:......|.  :.:.|.||..|:.||.
plant   454 LYYLHQQWVQVIIHRDIKPANILLDANMNAKLGDFGLAKLCDHGTDP--QTSHVAGTLGYISPEL 516

  Fly   396 RNFRQLSTGVDVYSFGIVLLEVFTGRQ-VTDRVPENETKKNLLDYVKQQW-RQNRMELLEKHLAA 458
            ....:.||..||::||||:||:..||: :..|..:.|..  |.|:|.:.| .::.|::|:..:  
plant   517 SRTGKASTRSDVFAFGIVMLEIACGRKPILPRASQREMV--LTDWVLECWENEDIMQVLDHKI-- 577

  Fly   459 PMGKEL--DMCMCAIEAGLHCTALDPQDRPSMNAVLK 493
              |:|.  :.....::.||.|:......||:|::|::
plant   578 --GQEYVEEQAALVLKLGLFCSHPVAAIRPNMSSVIQ 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 94/281 (33%)
TyrKc 219..495 CDD:197581 94/281 (33%)
AT1G70110NP_177168.1 lectin_legume_LecRK_Arcelin_ConA 26..260 CDD:173887
STKc_IRAK 350..615 CDD:270968 94/281 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.