DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G69910

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177149.2 Gene:AT1G69910 / 843327 AraportID:AT1G69910 Length:636 Species:Arabidopsis thaliana


Alignment Length:404 Identity:109/404 - (26%)
Similarity:181/404 - (44%) Gaps:73/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SELRAAPDSSAKVNNGP-------------PFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHI 188
            |||....|::.:||:..             .|..:..:..|......::..||.|:...|.:   
plant   240 SELVTQRDNNKRVNHIAVLSLIFALTCLLLVFSVAVAIFRSRRASFLSSINEEDPAALFLRH--- 301

  Fly   189 STVQRAAESLLEI-DYAELENATDGWSPDNRLGQGGFGDVYRGKWK--QLDVAIKVMNYR----- 245
               .|:|..|..: .:.|||:||:.:.|..::|.||||.||.|:..  || :|:|.:::.     
plant   302 ---HRSAALLPPVFTFEELESATNKFDPKRKIGDGGFGSVYLGQLSDGQL-LAVKFLHHHHGATA 362

  Fly   246 SPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQN 310
            :.....|...::...||:..|:||.|.|::.|:||........||:..:..|:|...|....   
plant   363 AATEHCKAFSMKSFCNEILILSSINHPNLVKLHGYCSDPRGLLLVHDYVTNGTLADHLHGRG--- 424

  Fly   311 PLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR------ 369
              |.:||:.|..|:|.||..:.:||.....|::|.||..:||.:::.::.|:|||||.|      
plant   425 --PKMTWRVRLDIALQTALAMEYLHFDIVPPVVHRDITSSNIFVEKDMKIKVGDFGLSRLLVFSE 487

  Fly   370 -------------EGPKSLDAVVEVNKVFGTKIYLPPEF-RNFRQLSTGVDVYSFGIVLLEVFTG 420
                         .||:            ||..||.|:: |:|| |:...||||:|:||:|:.||
plant   488 TTVNSATSSDYVCTGPQ------------GTPGYLDPDYHRSFR-LTEKSDVYSYGVVLMELITG 539

  Fly   421 RQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPMGKEL-----DMCMCAI-EAGLHCTA 479
            .:..|:..|..... |.|.|..:.:...::.:...|.|..|.::     ...:.|: |....|.|
plant   540 MKAVDQRREKRDMA-LADLVVSKIQMGLLDQVIDPLLALDGDDVAAVSDGFGVAAVAELAFRCVA 603

  Fly   480 LDPQDRPSMNAVLK 493
            .|..|||....:::
plant   604 TDKDDRPDAKEIVQ 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 88/308 (29%)
TyrKc 219..495 CDD:197581 88/308 (29%)
AT1G69910NP_177149.2 WAK_assoc <195..235 CDD:373037
PKc_like 330..622 CDD:389743 88/308 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.