DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G69790

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177137.2 Gene:AT1G69790 / 843315 AraportID:AT1G69790 Length:387 Species:Arabidopsis thaliana


Alignment Length:394 Identity:121/394 - (30%)
Similarity:185/394 - (46%) Gaps:69/394 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 DSSAKV-NNGPPFPSSSGVSN----------------SNNNRTSTTATEEIPSLESLGNIHISTV 191
            ||||:| |....|..||.:|.                |||:.|:::.:...|..|  |.:..|..
plant     6 DSSARVGNRESTFGGSSRISRKPNQSSRLSSLTIPSYSNNSFTTSSWSNLTPRSE--GELLPSPT 68

  Fly   192 QRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKW------------KQLDVAIKVMNY 244
            .:|      ..:.||:.||..:.|::.:|:||||.||:| |            ..:.||:|.:. 
plant    69 LKA------FTFNELKTATRNFKPNSMIGEGGFGCVYKG-WIGERSLSPSKPGSGMVVAVKKLK- 125

  Fly   245 RSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQ 309
                 .:.....::...|:.||..:.|.|::.|.||.::|.|..|||:.|..||||..|....|:
plant   126 -----SEGFQGHKEWLTEVHYLGRLHHMNLVKLIGYCLEGEKRLLVYEYMPKGSLENHLFRRGAE 185

  Fly   310 NPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKS 374
             |:|   |:.|..::...|||:.|||.|:   :|:.|.|.:|||||.....|:.||||.:.||..
plant   186 -PIP---WKTRMKVAFSAARGLSFLHEAK---VIYRDFKASNILLDVDFNAKLSDFGLAKAGPTG 243

  Fly   375 LDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDY 439
             |......:|.||:.|..||:....:|::..||||||:||||:.:||...|: .:...::||:| 
plant   244 -DRTHVTTQVIGTQGYAAPEYIATGRLTSKSDVYSFGVVLLELLSGRPTLDK-SKVGVERNLVD- 305

  Fly   440 VKQQW-------RQNRMELLEKHLAAPMGKELDMCMC-AIEAGLHCTALDPQDRPSMNAVLKRFE 496
                |       |:....:::..|.   |:......| |....|.|...:|:.||.|..||...:
plant   306 ----WAIPYLVDRRKVFRIMDTKLG---GQYPHKGACAAANIALRCLNTEPKLRPDMADVLSTLQ 363

  Fly   497 PFVT 500
            ...|
plant   364 QLET 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 96/298 (32%)
TyrKc 219..495 CDD:197581 96/295 (33%)
AT1G69790NP_177137.2 STKc_IRAK 90..365 CDD:270968 96/298 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.