DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G69730

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177131.1 Gene:AT1G69730 / 843309 AraportID:AT1G69730 Length:792 Species:Arabidopsis thaliana


Alignment Length:315 Identity:100/315 - (31%)
Similarity:156/315 - (49%) Gaps:34/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD---VAIKVMNYRSPNI 249
            |||| ...|..:.....|||.||:.:|.:..|||||.|.||:|  ..:|   ||:|    :|..:
plant   423 ISTV-GMVEKTIVFSSRELEKATENFSSNRILGQGGQGTVYKG--MLVDGRIVAVK----KSKVV 480

  Fly   250 DQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPA 314
            |:.  :|::..||:..|:.|.|.||:.|.|..::...|.|||:.:..|:|...|.....:|.:  
plant   481 DED--KLEEFINEVVILSQINHRNIVKLLGCCLETKVPVLVYEFIPNGNLFEHLHDEFDENIM-- 541

  Fly   315 LTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVV 379
            .||..|..|::..|..:.:||::..:|:.|.|:|..||:||:..:.|:.|||..|  ..::|...
plant   542 ATWNIRLRIAIDIAGALSYLHSSASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSR--TVTVDHTH 604

  Fly   380 EVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD--RVPENETKKNLLDYVKQ 442
            ....|.||..|:.||:....|.:...||||||:||:|:.||.:...  |..||.|   |..|...
plant   605 LTTVVSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLVELITGEKSISFLRSQENRT---LATYFIL 666

  Fly   443 QWRQNRM-ELLEKHLAAPMGKELDMCM-----CAIEAGLHCTALDPQDRPSMNAV 491
            ..::|:: ::::..:.       |.||     ...:....|..|..:.||||..|
plant   667 AMKENKLFDIIDARIR-------DGCMLSQVTATAKVARKCLNLKGRKRPSMREV 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 89/284 (31%)
TyrKc 219..495 CDD:197581 89/284 (31%)
AT1G69730NP_177131.1 GUB_WAK_bind 31..144 CDD:372835
WAK 202..311 CDD:254827
PKc_like 453..721 CDD:389743 89/284 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.