DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G61590

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_176353.1 Gene:AT1G61590 / 842455 AraportID:AT1G61590 Length:424 Species:Arabidopsis thaliana


Alignment Length:381 Identity:114/381 - (29%)
Similarity:190/381 - (49%) Gaps:52/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLE 200
            :|..|.:....:| |:..|.||...:|.::.:|:|:....|            ...|.....|::
plant    35 LSRCRPSRSEFSK-NHLGPLPSFRRLSFADLSRSSSARINE------------DLAQTLGADLVD 86

  Fly   201 IDYAELENATDGWSPDNRLGQGGFGDVYRG--------KWKQLDVAIKVMNYRSPNIDQKMVELQ 257
            ....||:..|..:|.:..||:||||.||:|        ..|...||:|:::          :|..
plant    87 FQMCELKMITQSFSGNYLLGEGGFGKVYKGYVDDYLRQSLKAQPVAVKLLD----------IEGL 141

  Fly   258 QSY----NELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQ 318
            |.:    :|:.:|..::|.|::.|.||..:..:..|:|:.|..||||    .|..:....:|.|.
plant   142 QGHREWLSEVIFLGQLKHPNLVKLIGYCCEEEERVLIYEFMPRGSLE----NHLFRRISLSLPWA 202

  Fly   319 QRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNK 383
            .|..|::..|:|:.|||... :|:|:.|.|.:|||||.....|:.||||.:.||:...:.| ..:
plant   203 TRLKIAVAAAKGLAFLHDLE-SPIIYRDFKTSNILLDSDFTAKLSDFGLAKMGPEGSKSHV-TTR 265

  Fly   384 VFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRV-PENETKKNLLDYVKQQWRQN 447
            |.||..|..||:.:...|:|..||||:|:||||:.|||:.|::. |:|:  :|::|:.|.....:
plant   266 VMGTYGYAAPEYVSTGHLTTKSDVYSYGVVLLELLTGRRATEKSRPKNQ--QNIIDWSKPYLTSS 328

  Fly   448 RME--LLEKHLAAPMGKEL--DMCMCAIEAGLHCTALDPQDRPSMNAVLKRFEPFV 499
            |..  :::..||.....:.  |..:.|    |.|.:.:|:|||.|.||::..|..:
plant   329 RRLRCVMDPRLAGQYSVKAAKDTALLA----LQCVSPNPKDRPKMLAVVEALESLI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 97/295 (33%)
TyrKc 219..495 CDD:197581 96/292 (33%)
AT1G61590NP_176353.1 STKc_IRAK 105..379 CDD:270968 97/295 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.920

Return to query results.
Submit another query.