DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G52310

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_175641.1 Gene:AT1G52310 / 841661 AraportID:AT1G52310 Length:552 Species:Arabidopsis thaliana


Alignment Length:300 Identity:84/300 - (28%)
Similarity:145/300 - (48%) Gaps:17/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ELENATDGWSPDNRL-GQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLN 267
            ||.:.|..:|..||| |....|..|.|.... ..||:|  ..:..:..:|    ::.|:|::...
plant   259 ELRSMTKNFSEANRLAGDAKTGGTYSGGLSDGTKVAVK--RLKRSSFQRK----KEFYSEIRRAA 317

  Fly   268 SIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIY 332
            .:.|.|::|:.|.....|:..:||:.:..|.|:..|  |.......:|.|..|.:|:...|:||.
plant   318 KLYHPNVVAIKGCCYDHGERFIVYEFIASGPLDRWL--HHVPRGGRSLDWNMRLNIATTLAQGIA 380

  Fly   333 FLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVF--GTKIYLPPEF 395
            |||......::|.||:.:|:|||:.....:...||.:..|..   |::...|.  ||..||.||:
plant   381 FLHDKVKPQVVHRDIRASNVLLDEEFGAHLMGVGLSKFVPWE---VMQERTVMAGGTYGYLAPEY 442

  Fly   396 RNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR-MELLEKHLAAP 459
            ....:|:|..||||||::|||:.:||:.|..|..:...:::.::.....:.|| :|:|:..:...
plant   443 VYRNELTTKSDVYSFGVLLLEIVSGRRPTQAVNSSVGWQSIFEWATPLVQANRWLEILDPVITCG 507

  Fly   460 MGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFEPFV 499
            : .|..:....::....||...|..||.|:.|:.:.:..|
plant   508 L-PEACVVQKVVDLVYSCTQNVPSMRPRMSHVVHQLQQLV 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 77/283 (27%)
TyrKc 219..495 CDD:197581 77/280 (28%)
AT1G52310NP_175641.1 CLECT 50..187 CDD:214480
PKc_like 280..545 CDD:389743 75/276 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.