DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PERK15

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_175639.1 Gene:PERK15 / 841659 AraportID:AT1G52290 Length:509 Species:Arabidopsis thaliana


Alignment Length:345 Identity:109/345 - (31%)
Similarity:172/345 - (49%) Gaps:46/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGK 231
            ||.|....::..:|:...:..|      .::|  ..|.:|..||..:|..|.|||||||.|:|| 
plant   105 NRDSLDPKDDSNNLQQWSSSEI------GQNL--FTYEDLSKATSNFSNTNLLGQGGFGYVHRG- 160

  Fly   232 WKQLD---VAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQL 293
             ..:|   ||||.:...|   .|...|.|.   |::.::.:.|.::::|.||.|.|.:..|||:.
plant   161 -VLVDGTLVAIKQLKSGS---GQGEREFQA---EIQTISRVHHRHLVSLLGYCITGAQRLLVYEF 218

  Fly   294 MKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCL 358
            :...:||..|  |:.:.|:  :.|.:|..|:||.|:|:.:||.......||.|:|.||||:|...
plant   219 VPNKTLEFHL--HEKERPV--MEWSKRMKIALGAAKGLAYLHEDCNPKTIHRDVKAANILIDDSY 279

  Fly   359 QPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQ 422
            :.|:.||||.|   .|||....|: ::.||..||.||:.:..:|:...||:|.|:||||:.|||:
plant   280 EAKLADFGLAR---SSLDTDTHVSTRIMGTFGYLAPEYASSGKLTEKSDVFSIGVVLLELITGRR 341

  Fly   423 VTDRVPENETKKNLLDYVKQQWRQ-----NRMELLEKHLAAPMGKELD------MCMCAIEAGLH 476
            ..|:........:::|:.|....|     |...|::..|.    .:.|      |..||..:..|
plant   342 PVDKSQPFADDDSIVDWAKPLMIQALNDGNFDGLVDPRLE----NDFDINEMTRMVACAAASVRH 402

  Fly   477 CTALDPQDRPSMNAVLKRFE 496
                ..:.||.|:.:::.||
plant   403 ----SAKRRPKMSQIVRAFE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 97/293 (33%)
TyrKc 219..495 CDD:197581 95/290 (33%)
PERK15NP_175639.1 PKc_like 149..419 CDD:304357 97/293 (33%)
Pkinase_Tyr 149..417 CDD:285015 95/290 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.