DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G51870

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001323131.1 Gene:AT1G51870 / 841614 AraportID:AT1G51870 Length:889 Species:Arabidopsis thaliana


Alignment Length:353 Identity:102/353 - (28%)
Similarity:160/353 - (45%) Gaps:53/353 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDG 212
            |...|||...:||.:.|....::       ||:.....              :|.|.::...|:.
plant   541 KSAEGPPLSVTSGTAKSETRSSN-------PSIMRKDR--------------KITYPQVLKMTNN 584

  Fly   213 WSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSPNIDQKMVELQQSYNELK----YLNSIRHDN 273
            :  :..||:||||.||.|..:...||:|::::.|          .|.|.|.|    .|..:.|.:
plant   585 F--ERVLGKGGFGTVYHGNMEDAQVAVKMLSHSS----------AQGYKEFKAEVELLLRVHHRH 637

  Fly   274 ILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTAR 338
            ::.|.||...|....|:|:.|..|.|...:...:..|   .|||:.|..|::..|:|:.:||...
plant   638 LVGLVGYCDDGDNLALIYEYMANGDLRENMLGKRGGN---VLTWENRMQIAVEAAQGLEYLHNGC 699

  Fly   339 GTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVF-GTKIYLPPEFRNFRQLS 402
            ..|::|.|:|..||||:.....|:.||||.|..|  :|....|:.|. ||..||.||:.....||
plant   700 TPPMVHRDVKTTNILLNAQCGAKLADFGLSRSFP--IDGECHVSTVVAGTPGYLDPEYYRTNWLS 762

  Fly   403 TGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAP--MGK-EL 464
            ...||||||:||||:.|.:.|.::..|   :.::.::|.....:..:    |.:..|  ||. :.
plant   763 EKSDVYSFGVVLLEIVTNQPVINQTRE---RPHINEWVGFMLSKGDI----KSIVDPKLMGDYDT 820

  Fly   465 DMCMCAIEAGLHCTALDPQDRPSMNAVL 492
            :.....:|.||.|.......||:|..|:
plant   821 NGAWKIVELGLACVNPSSNLRPTMAHVV 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 90/282 (32%)
TyrKc 219..495 CDD:197581 90/282 (32%)
AT1G51870NP_001323131.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.