DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G51830

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001323323.1 Gene:AT1G51830 / 841610 AraportID:AT1G51830 Length:700 Species:Arabidopsis thaliana


Alignment Length:365 Identity:101/365 - (27%)
Similarity:167/365 - (45%) Gaps:80/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLL-----EIDYAELENA 209
            :.|||    :....::|.|:                      :|:||..:     ...|:|:...
plant   353 SKGPP----AAYVQASNGRS----------------------RRSAEPAIVTKNKRFTYSEVMQM 391

  Fly   210 TDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMVELQQSYN----ELKYLNSI 269
            |:.:  ...||:||||.||.|.....: ||||::::.|          .|.|.    |::.|..:
plant   392 TNNF--QRVLGKGGFGIVYHGLVNGTEQVAIKILSHSS----------SQGYKQFKAEVELLLRV 444

  Fly   270 RHDNILALYGYSIKGGKPCLVYQLMKGGSLEARL---RAHKAQNPLPALTWQQRFSISLGTARGI 331
            .|.|::.|.||..:|....|:|:.|..|.|:..:   |.|.      .|.|..|..|.:.:|:|:
plant   445 HHKNLVGLVGYCDEGENLALIYEYMANGDLKEHMSGTRNHF------ILNWGTRLKIVVESAQGL 503

  Fly   332 YFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KVFGTKIYLPPEF 395
            .:||......::|.|||..||||::....|:.||||.|..|  ::....|: .|.||..||.||:
plant   504 EYLHNGCKPLMVHRDIKTTNILLNEQFDAKLADFGLSRSFP--IEGETHVSTAVAGTPGYLDPEY 566

  Fly   396 RNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRME-LLEKHL--- 456
            .....|:...||||||:||||:.|.:.|.|  |..| |.::.::|.:...:..:: :::..|   
plant   567 YRTNWLTEKSDVYSFGVVLLEIITNQPVID--PRRE-KPHIAEWVGEVLTKGDIKNIMDPSLNGD 628

  Fly   457 --AAPMGKELDMCMCAIEAGLHCTALDPQD--RPSMNAVL 492
              :..:.|.:::.||         .|:|..  ||:|:.|:
plant   629 YDSTSVWKAVELAMC---------CLNPSSARRPNMSQVV 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 90/291 (31%)
TyrKc 219..495 CDD:197581 90/291 (31%)
AT1G51830NP_001323323.1 Malectin_like <17..164 CDD:403886
PLN00113 206..>298 CDD:215061
leucine-rich repeat 225..245 CDD:275380
leucine-rich repeat 246..269 CDD:275380
leucine-rich repeat 270..294 CDD:275380
STKc_IRAK 399..664 CDD:270968 90/291 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.