DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PERK7

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_175353.1 Gene:PERK7 / 841351 AraportID:AT1G49270 Length:699 Species:Arabidopsis thaliana


Alignment Length:384 Identity:119/384 - (30%)
Similarity:183/384 - (47%) Gaps:44/384 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PRSVPT--ISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQ 192
            |.|:.|  :|.....|..:.:....||.|.|.|.:...:...|:..:.. |...||...|.|...
plant   254 PGSMGTNWVSSPPPPPPGNWQPMPSPPAPVSGGANVIQSGEMSSNFSSG-PYAPSLPPPHPSVAL 317

  Fly   193 RAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVEL 256
            ....|  ...|.||.:||.|:|.|..|||||||.|::|.... .::|:|.:...|   .|...|.
plant   318 GFNNS--TFTYEELASATQGFSKDRLLGQGGFGYVHKGILPNGKEIAVKSLKAGS---GQGEREF 377

  Fly   257 QQSYNELKYLNSIRHDNILALYGY-SIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQR 320
            |.   |::.::.:.|.::::|.|| |..||:..|||:.:...:||..|.....    ..:.|..|
plant   378 QA---EVEIISRVHHRHLVSLVGYCSNAGGQRLLVYEFLPNDTLEFHLHGKSG----TVMDWPTR 435

  Fly   321 FSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVN-KV 384
            ..|:||:|:|:.:||......:||.|||.:|||||...:.|:.||||.:   .|.|....|: :|
plant   436 LKIALGSAKGLAYLHEDCHPKIIHRDIKASNILLDHNFEAKVADFGLAK---LSQDNNTHVSTRV 497

  Fly   385 FGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDY-------VKQ 442
            .||..||.||:.:..:|:...||:|||::|||:.|||...|.  ..:.:.:|:|:       |.|
plant   498 MGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRGPVDL--SGDMEDSLVDWARPLCMRVAQ 560

  Fly   443 QWRQNRMELLE---KHLAAP--MGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            .....  ||::   :|...|  |.:   |..||..|..|    ..:.||.|:.:::..|
plant   561 DGEYG--ELVDPFLEHQYEPYEMAR---MVACAAAAVRH----SGRRRPKMSQIVRTLE 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 94/293 (32%)
TyrKc 219..495 CDD:197581 93/290 (32%)
PERK7NP_175353.1 PKc_like 342..612 CDD:389743 94/293 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.