DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G01540

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_171661.1 Gene:AT1G01540 / 839533 AraportID:AT1G01540 Length:472 Species:Arabidopsis thaliana


Alignment Length:391 Identity:115/391 - (29%)
Similarity:188/391 - (48%) Gaps:49/391 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VSEDLHKYIP---RSVPT-----ISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEI 177
            :|:::.:.:|   :|||.     |.::......|.:|::|    .|.|.::::...:.:.:....
plant    70 ISKEIKEIVPAQNQSVPAEIQVDIGKIEHRVVFSDRVSSG----ESRGTASASETASYSGSGNCG 130

  Fly   178 PSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIK- 240
            |.:..||.....|::            |||.||:|...:|.:|:||:|.||||.... ..||:| 
plant   131 PEVSHLGWGRWYTLR------------ELEAATNGLCEENVIGEGGYGIVYRGILTDGTKVAVKN 183

  Fly   241 VMNYRSPNIDQKMVELQQSYN-ELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLR 304
            ::|.|.        :.::.:. |::.:..:||.|::.|.||.::|....|||..:..|:||..: 
plant   184 LLNNRG--------QAEKEFKVEVEVIGRVRHKNLVRLLGYCVEGAYRMLVYDFVDNGNLEQWI- 239

  Fly   305 AHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVR 369
             |.....:..|||..|.:|.||.|:|:.:||......::|.|||.:|||||:....|:.||||.:
plant   240 -HGDVGDVSPLTWDIRMNIILGMAKGLAYLHEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAK 303

  Fly   370 -EGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD-RVPENET 432
             .|.:|......|...||   |:.||:.....|:...|:|||||:::|:.|||...| ..|:.||
plant   304 LLGSESSYVTTRVMGTFG---YVAPEYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGET 365

  Fly   433 KKNLLDYVKQQWRQNRMELL--EKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRF 495
              ||:|::|......|.|.:  .|....|..|.|...:.   ..|.|...|...||.|..::...
plant   366 --NLVDWLKSMVGNRRSEEVVDPKIPEPPSSKALKRVLL---VALRCVDPDANKRPKMGHIIHML 425

  Fly   496 E 496
            |
plant   426 E 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 1/6 (17%)
STKc_IRAK 219..498 CDD:270968 93/285 (33%)
TyrKc 219..495 CDD:197581 92/282 (33%)
AT1G01540NP_171661.1 STKc_IRAK 160..426 CDD:270968 92/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.