DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G24030

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173814.2 Gene:AT1G24030 / 839015 AraportID:AT1G24030 Length:375 Species:Arabidopsis thaliana


Alignment Length:303 Identity:99/303 - (32%)
Similarity:159/303 - (52%) Gaps:27/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ELENATDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMVELQQSYN-ELKYLN 267
            |:|.||..:|.:|.||:||||.||:|..|..: ||||.|:.  |..  |..:.::.:. |:..|:
plant    68 EMEEATSSFSDENLLGKGGFGRVYQGTLKTGEVVAIKKMDL--PTF--KKADGEREFRVEVDILS 128

  Fly   268 SIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIY 332
            .:.|.|:::|.||...|....|||:.|:.|:|:..|...|...    ::|..|..|:||.|:|:.
plant   129 RLDHPNLVSLIGYCADGKHRFLVYEYMQNGNLQDHLNGIKEAK----ISWPIRLRIALGAAKGLA 189

  Fly   333 FLHTAR--GTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEF 395
            :||::.  |.|::|.|.|..|:|||.....||.||||.:..|:..|..|.. :|.||..|..||:
plant   190 YLHSSSSVGIPIVHRDFKSTNVLLDSNYNAKISDFGLAKLMPEGKDTCVTA-RVLGTFGYFDPEY 253

  Fly   396 RNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAPM 460
            .:..:|:...|:|:||:||||:.|||:..| :.:...::||:..|:.....      .|.|...:
plant   254 TSTGKLTLQSDIYAFGVVLLELLTGRRAVD-LTQGPNEQNLVLQVRNILND------RKKLRKVI 311

  Fly   461 GKELDMCMCAIEA-------GLHCTALDPQDRPSMNAVLKRFE 496
            ..||.....::||       ...|..::.::|||:...:|..:
plant   312 DVELPRNSYSMEAITMFADLASRCIRIESKERPSVMDCVKELQ 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 93/289 (32%)
TyrKc 219..495 CDD:197581 93/286 (33%)
AT1G24030NP_173814.2 STKc_IRAK 82..356 CDD:270968 93/289 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.