DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and WAK2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173549.1 Gene:WAK2 / 838723 AraportID:AT1G21270 Length:732 Species:Arabidopsis thaliana


Alignment Length:330 Identity:101/330 - (30%)
Similarity:156/330 - (47%) Gaps:43/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GNIHISTVQRAAESLLEID-YAE--LENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYR 245
            |.:.|..|..|..|.:::. :.|  ::.||:|:.....|||||.|.||:|......: :.:...|
plant   372 GGMLIQRVSGAGPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSI-VAIKKAR 435

  Fly   246 SPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQN 310
            ..|..|    ::|..||:..|:.|.|.|::.:.|..::...|.|||:.:..|:|...|......:
plant   436 LGNRSQ----VEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDS 496

  Fly   311 PLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSL 375
               :|||:.|..|:...|..:.:||::...|:||.|||.||||||:.|..|:.|||..|..|...
plant   497 ---SLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDK 558

  Fly   376 DAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQV----TDRVPEN------ 430
            :.:..:  |.||..||.||:.|...|:...||||||:||:|:.:|::.    ....|:|      
plant   559 EQLTTI--VQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFA 621

  Fly   431 -ETKKNLLDYV---KQQWRQNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAV 491
             .||.|....:   :.....|:.|:.|   ||.:..|             ||.|..::||.|..|
plant   622 SATKNNRFHEIIDGQVMNEDNQREIQE---AARIAAE-------------CTRLMGEERPRMKEV 670

  Fly   492 LKRFE 496
            ....|
plant   671 AAELE 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 92/292 (32%)
TyrKc 219..495 CDD:197581 91/289 (31%)
WAK2NP_173549.1 GUB_WAK_bind 29..127 CDD:372835
EGF_CA 278..>311 CDD:311536
STKc_IRAK 410..677 CDD:270968 92/292 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.