DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and WAK3

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173547.1 Gene:WAK3 / 838719 AraportID:AT1G21240 Length:741 Species:Arabidopsis thaliana


Alignment Length:325 Identity:102/325 - (31%)
Similarity:160/325 - (49%) Gaps:44/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VQR-AAESLLEIDY-----AELENATDGWSPDNRLGQGGFGDVYRGKW-KQLDVAIKVMNYRSPN 248
            :|| :...|..||:     ..::.||:|:.....|||||.|.||:|.. ....||||    ::..
plant   387 IQRLSGAGLSNIDFKIFTEEGMKEATNGYDESRILGQGGQGTVYKGILPDNTIVAIK----KARL 447

  Fly   249 IDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLP 313
            .|.:.|:  |..:|:..|:.|.|.|::.:.|..::...|.|||:.:..|:|...|......:   
plant   448 ADSRQVD--QFIHEVLVLSQINHRNVVKILGCCLETEVPLLVYEFITNGTLFDHLHGSIFDS--- 507

  Fly   314 ALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFG---LVREGPKSL 375
            :|||:.|..|::..|..:.:||::...|:||.|||.||||||:.|..|:.|||   |:....:.|
plant   508 SLTWEHRLRIAIEVAGTLAYLHSSASIPIIHRDIKTANILLDENLTAKVADFGASKLIPMDKEQL 572

  Fly   376 DAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVT--DRVPENETKKNLLD 438
            ..:|:     ||..||.||:.....|:...||||||:||:|:.:|::..  :|   .:..|:|:.
plant   573 TTMVQ-----GTLGYLDPEYYTTGLLNEKSDVYSFGVVLMELLSGQKALCFER---PQASKHLVS 629

  Fly   439 YVKQQWRQNRME-------LLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            |......:||:.       |.|.:|     ||:..   |......||.|..::||.|..|..:.|
plant   630 YFVSATEENRLHEIIDDQVLNEDNL-----KEIQE---AARIAAECTRLMGEERPRMKEVAAKLE 686

  Fly   497  496
            plant   687  686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 94/291 (32%)
TyrKc 219..495 CDD:197581 93/288 (32%)
WAK3NP_173547.1 GUB_WAK_bind 31..129 CDD:290658
EGF_CA 293..328 CDD:284955
STKc_IRAK 421..688 CDD:270968 94/291 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.