DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and WAK4

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173544.1 Gene:WAK4 / 838716 AraportID:AT1G21210 Length:738 Species:Arabidopsis thaliana


Alignment Length:296 Identity:99/296 - (33%)
Similarity:154/296 - (52%) Gaps:22/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LENATDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMVELQQSYNELKYLNSI 269
            ::.||||:..:..|||||.|.||:|...... ||||    ::...|...||  |..||:..|:.|
plant   403 MKEATDGYDENRILGQGGQGTVYKGILPDNSIVAIK----KARLGDNSQVE--QFINEVLVLSQI 461

  Fly   270 RHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFL 334
            .|.|::.|.|..::...|.|||:.:..|:|...|......:   :|||:.|..:::..|..:.:|
plant   462 NHRNVVKLLGCCLETEVPLLVYEFISSGTLFDHLHGSMFDS---SLTWEHRLRMAVEIAGTLAYL 523

  Fly   335 HTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFR 399
            |::...|:||.|||.||||||:.|..|:.|||..|..|  :|.......|.||..||.||:.|..
plant   524 HSSASIPIIHRDIKTANILLDENLTAKVADFGASRLIP--MDKEDLATMVQGTLGYLDPEYYNTG 586

  Fly   400 QLSTGVDVYSFGIVLLEVFTGRQVT--DRVPENETKKNLLDYVKQQWRQNRM-ELLEKHLAAPMG 461
            .|:...||||||:||:|:.:|::..  :|   .:|.|:::.|.....::||: |:::..:.....
plant   587 LLNEKSDVYSFGVVLMELLSGQKALCFER---PQTSKHIVSYFASATKENRLHEIIDGQVMNENN 648

  Fly   462 -KELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
             :|:..   |....:.||.|..::||.|..|....|
plant   649 QREIQK---AARIAVECTRLTGEERPGMKEVAAELE 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 95/283 (34%)
TyrKc 219..495 CDD:197581 94/280 (34%)
WAK4NP_173544.1 GUB_WAK_bind 25..125 CDD:372835
EGF_CA 279..324 CDD:311536
STKc_IRAK 416..683 CDD:270968 95/283 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.