DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and ASG5

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173489.2 Gene:ASG5 / 838654 AraportID:AT1G20650 Length:381 Species:Arabidopsis thaliana


Alignment Length:375 Identity:122/375 - (32%)
Similarity:181/375 - (48%) Gaps:44/375 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PTISELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESL 198
            |...::|...| :|:.|:  .:.:.|.|..|:     ||.||.|..:...|.::.......|.| 
plant    10 PRTKDIRVDID-NARCNS--RYQTDSSVHGSD-----TTGTESISGILVNGKVNSPIPGGGARS- 65

  Fly   199 LEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD----VAIKVMNYRSPNIDQKMVELQQS 259
              ..:.||..||..:...|.||:||||.||:|:   ||    ||||.:|......:::.:.    
plant    66 --FTFKELAAATRNFREVNLLGEGGFGRVYKGR---LDSGQVVAIKQLNPDGLQGNREFIV---- 121

  Fly   260 YNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARL-RAHKAQNPLPALTWQQRFSI 323
              |:..|:.:.|.|::.|.||...|.:..|||:.|..||||..| .....|.|   |:|..|..|
plant   122 --EVLMLSLLHHPNLVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESNQEP---LSWNTRMKI 181

  Fly   324 SLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTK 388
            ::|.||||.:||.....|:|:.|:|.||||||:...||:.||||.:.||.. |......:|.||.
plant   182 AVGAARGIEYLHCTANPPVIYRDLKSANILLDKEFSPKLSDFGLAKLGPVG-DRTHVSTRVMGTY 245

  Fly   389 IYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLL----DYVKQQWRQNRM 449
            .|..||:....:|:...|:|.||:||||:.|||:..| :.:.:.::||:    .|:|.|.:..  
plant   246 GYCAPEYAMSGKLTVKSDIYCFGVVLLELITGRKAID-LGQKQGEQNLVTWSRPYLKDQKKFG-- 307

  Fly   450 ELLEKHLAAP--MGKELDMCM-CAIEAGLHCTALDPQDRPSMNAVLKRFE 496
                 ||..|  .||....|: .||.....|...:...||.:..::...|
plant   308 -----HLVDPSLRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALE 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 101/290 (35%)
TyrKc 219..495 CDD:197581 100/287 (35%)
ASG5NP_173489.2 STKc_IRAK 84..352 CDD:270968 100/288 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.