DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G19390

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173372.1 Gene:AT1G19390 / 838522 AraportID:AT1G19390 Length:788 Species:Arabidopsis thaliana


Alignment Length:296 Identity:92/296 - (31%)
Similarity:149/296 - (50%) Gaps:19/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ELENATDGWSPDNRLGQGGFGDVYRGKWKQLD---VAIKVMNYRSPNIDQKMVELQQSYNELKYL 266
            |||.|||.:|....|||||.|.||:|  ..:|   ||:|    :|..:|:.  :|::..||:..|
plant   443 ELEKATDNFSESRILGQGGQGTVYKG--MLVDGRTVAVK----KSKVVDED--KLEEFINEVVIL 499

  Fly   267 NSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGI 331
            :.|.|.:::.|.|..::...|.|||:.:..|:|...:  |:..:.. ..||..|..|::..|..:
plant   500 SQINHRHVVKLLGCCLETEVPTLVYEFIPNGNLFQHI--HEESDDY-TKTWGMRLRIAVDIAGAL 561

  Fly   332 YFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFR 396
            .:||:|..:|:.|.|||..|||||:..:.|:.|||..|.  .::|.......:.||..|:.||:.
plant   562 SYLHSAASSPIYHRDIKSTNILLDEKYRTKVSDFGTSRS--VTIDHTHWTTVISGTVGYVDPEYY 624

  Fly   397 NFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNR-MELLEKHLAAPM 460
            ...|.:...||||||:||:|:.||.:....|..::..:.|.|:.:...::|| .|:::..:..  
plant   625 GSSQYTDKSDVYSFGVVLVELITGEKPVITVSNSQEIRGLADHFRVAMKENRFFEIMDARIRD-- 687

  Fly   461 GKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            |.:.:..|........|.....:.||.|..|....|
plant   688 GCKPEQVMAVANLARRCLNSKGKKRPCMRKVFTDLE 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 85/282 (30%)
TyrKc 219..495 CDD:197581 84/279 (30%)
AT1G19390NP_173372.1 GUB_WAK_bind 29..142 CDD:372835
WAK 200..310 CDD:254827
STKc_IRAK 457..725 CDD:270968 85/282 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.