DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and RKF2

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001319040.1 Gene:RKF2 / 838491 AraportID:AT1G19090 Length:615 Species:Arabidopsis thaliana


Alignment Length:404 Identity:113/404 - (27%)
Similarity:189/404 - (46%) Gaps:52/404 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YVSEDLHKYIPRSVPTISELRAAPDSSAKVNNGPPFPSSS---GVSNSNNNRTSTTATEEIPSLE 181
            |:....||:...:.      ...||:..:     .|..||   .:|:.:..|.:..|. .:..|.
plant   229 YLKYSTHKFFDDAA------EHKPDADQR-----NFIRSSFFPHLSDRDVTRLAIAAI-SLSILT 281

  Fly   182 SLGNI----HISTVQRA-AESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIK 240
            |||..    .:|..::| ..|.:...|..||.||:.:....:|||||.|.||:|.... ..||:|
plant   282 SLGAFISYRRVSRKRKAQVPSCVNFKYEMLEKATESFHDSMKLGQGGAGSVYKGILPXGRIVAVK 346

  Fly   241 VMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRA 305
            .:.:.:..      ...|.:||:..::.::|.|::.|.|.||:|.|..|||:.:...||:..|  
plant   347 KLFFNTRE------WADQFFNEVNLISGVQHKNLVRLLGCSIEGPKSLLVYEYVHNRSLDQIL-- 403

  Fly   306 HKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVRE 370
             ..:|.:..|:|:|||:|.:|.:.|:.:||......:||.|||.:|||||:.|.|||.||||:|.
plant   404 -FMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRS 467

  Fly   371 GPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKN 435
              ...|.......:.||..||.||:....||:...|||:||::::|:.||::      .|...:.
plant   468 --MGTDKTQTNTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKK------NNAFTQG 524

  Fly   436 LLDYVKQQWRQNRMELLEKHLAAPMGKEL--DMCMCAIEAGLHCTALDPQDRPSMNAVL------ 492
            ....:...|...:...|::.:...:....  :..:..::.||.|.....:.||||:.::      
plant   525 TSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSMSEIVFMLQNK 589

  Fly   493 -KRFE-----PFVT 500
             .:||     ||::
plant   590 DSKFEYPKQPPFLS 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 2/7 (29%)
STKc_IRAK 219..498 CDD:270968 88/293 (30%)
TyrKc 219..495 CDD:197581 86/285 (30%)
RKF2NP_001319040.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.