DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G18390

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001154349.1 Gene:AT1G18390 / 838420 AraportID:AT1G18390 Length:654 Species:Arabidopsis thaliana


Alignment Length:321 Identity:106/321 - (33%)
Similarity:157/321 - (48%) Gaps:27/321 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 PSLESLGNIHISTVQRAAESLLEI---DYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVA 238
            ||.:|.      .:::|.|.|:.:   .|.|||.||:.:.|...||.||||.||.||.|. ..||
plant   312 PSAKSF------DIEKAEELLVGVHIFSYEELEEATNNFDPSKELGDGGFGTVYYGKLKDGRSVA 370

  Fly   239 IKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKP-CLVYQLMKGGSLEAR 302
            :|.:      .|......:|..||::.|..:||.|::||:|.|.|..:. .|||:.:..|:|...
plant   371 VKRL------YDNNFKRAEQFRNEVEILTGLRHPNLVALFGCSSKQSRDLLLVYEYVANGTLADH 429

  Fly   303 LRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGL 367
            |...:| || .:|.|..|..|::.||..:.:||.::   :||.|:|..||||||....|:.||||
plant   430 LHGPQA-NP-SSLPWSIRLKIAVETASALKYLHASK---IIHRDVKSNNILLDQNFNVKVADFGL 489

  Fly   368 VREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRV-PENE 431
            .|..|  :|.........||..|:.|::....|||...|||||.:||:|:.:.....|.. |..|
plant   490 SRLFP--MDKTHVSTAPQGTPGYVDPDYHLCYQLSNKSDVYSFAVVLMELISSLPAVDITRPRQE 552

  Fly   432 TKKNLLDYVKQQWRQNRMELLEKHLAAPMGKELDMCMCAI-EAGLHCTALDPQDRPSMNAV 491
            ...:.:..||.|..:.| ::::..|.......:...:.|: |....|...|...||.|:.|
plant   553 INLSNMAVVKIQNHELR-DMVDPSLGFDTDTRVRQTVIAVAELAFQCLQSDKDLRPCMSHV 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 93/277 (34%)
TyrKc 219..495 CDD:197581 93/277 (34%)
AT1G18390NP_001154349.1 WAK_assoc <180..243 CDD:291078
TyrKc 347..616 CDD:197581 93/280 (33%)
PKc_like 350..619 CDD:304357 93/277 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.