DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G17910

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173233.1 Gene:AT1G17910 / 838370 AraportID:AT1G17910 Length:764 Species:Arabidopsis thaliana


Alignment Length:311 Identity:97/311 - (31%)
Similarity:152/311 - (48%) Gaps:15/311 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 ISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQ 251
            ::|.|...|........|||.|||.::.:..:||||.|.||:|.... ..||:|..|.    :|:
plant   429 LNTTQGRVEKTKLFSSRELEKATDNFNDNRVIGQGGQGTVYKGMLVDGRSVAVKKSNV----VDE 489

  Fly   252 KMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALT 316
            .  :||:..||:..|:.|.|.:::.|.|..::...|.|||:.:..|:|...|  |:..:...|| 
plant   490 D--KLQEFINEVIILSQINHRHVVKLLGCCLETEVPILVYEFIPNGNLFQHL--HEEFDDYTAL- 549

  Fly   317 WQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEV 381
            |..|..|::..:....:||||..:|:.|.|||..|||||:..:.|:.|||..|.  .|:|.....
plant   550 WGVRMRIAVDISGAFSYLHTAACSPIYHRDIKSTNILLDEKYRAKVSDFGTSRS--VSIDHTHWT 612

  Fly   382 NKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQ 446
            ..:.||..|:.||:......:...||||||:||:|:.||.:....:.|.:....|.||.:...|:
plant   613 TVISGTVGYVDPEYYGSSHFTEKSDVYSFGVVLVELITGEKPVITLSETQEITGLADYFRLAMRE 677

  Fly   447 NRM-ELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            ||: |:::..:....  :|:..:......|.|.....:.||.|..|....|
plant   678 NRLFEIIDARIRNDC--KLEQVIAVANLALRCLKKTGKTRPDMREVSTALE 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 88/280 (31%)
TyrKc 219..495 CDD:197581 87/277 (31%)
AT1G17910NP_173233.1 GUB_WAK_bind 25..142 CDD:372835
WAK 207..312 CDD:254827
PKc_like 460..728 CDD:389743 88/280 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.