DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G16260

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001185009.1 Gene:AT1G16260 / 838195 AraportID:AT1G16260 Length:720 Species:Arabidopsis thaliana


Alignment Length:289 Identity:87/289 - (30%)
Similarity:148/289 - (51%) Gaps:16/289 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 ELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNS 268
            :||||||.::....|||||.|.||:|..:. :.||:|    :|..:.::  .|::..||:..|:.
plant   382 DLENATDRFNASRILGQGGQGTVYKGMLEDGMIVAVK----KSKALKEE--NLEEFINEIILLSQ 440

  Fly   269 IRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYF 333
            |.|.|::.:.|..::...|.|||:.:...:|...|  |......| ::|:.|..|:...|..:.:
plant   441 INHRNVVKILGCCLETEVPILVYEFIPNRNLFDHL--HNPSEDFP-MSWEVRLCIACEVADALSY 502

  Fly   334 LHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNF 398
            ||:|...|:.|.|:|..|||||:..:.|:.|||:.|.  .::|.......|.||..|:.||:...
plant   503 LHSAVSIPIYHRDVKSTNILLDEKHRAKVSDFGISRS--VAIDDTHLTTIVQGTIGYVDPEYLQS 565

  Fly   399 RQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRM-ELLEKHLAAPMGK 462
            ...:...||||||::|:|:.||.:....:...|.:. |..|..:..|.:|: |:|:..:.....:
plant   566 NHFTGKSDVYSFGVLLIELLTGEKPVSLLRRQEVRM-LGAYFLEAMRNDRLHEILDARIKEECDR 629

  Fly   463 ELDMCMCAIEAGLHCTALDPQDRPSMNAV 491
            |  ..:...:....|.:|:.:.||:|..|
plant   630 E--EVLAVAKLARRCLSLNSEHRPTMRDV 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 81/275 (29%)
TyrKc 219..495 CDD:197581 81/275 (29%)
AT1G16260NP_001185009.1 GUB_WAK_bind 32..142 CDD:372835
WAK 171..270 CDD:254827
STKc_IRAK 396..663 CDD:270968 81/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.