DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and WAKL5

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173067.2 Gene:WAKL5 / 838185 AraportID:AT1G16160 Length:731 Species:Arabidopsis thaliana


Alignment Length:309 Identity:94/309 - (30%)
Similarity:155/309 - (50%) Gaps:29/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD---VAIKVMNYR 245
            ||:.:|.:         ....||:.|||.:|....||:|..|.||:|  ..:|   :|:|    |
plant   412 GNVDMSRL---------FSSEELKKATDNFSVKRVLGKGSQGTVYKG--MMVDGKIIAVK----R 461

  Fly   246 SPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQN 310
            |..:|:.  :|::..||:..|:.|.|.||:.|.|..::...|.|||:.:..|.:..||  |...:
plant   462 SKVVDED--KLEKFINEIILLSQINHRNIVKLIGCCLETEVPILVYEYIPNGDMFKRL--HDESD 522

  Fly   311 PLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSL 375
            .. |:||:.|..|::..|..:.::|:|...|:.|.|||..|||||:....|:.|||..|.  .::
plant   523 DY-AMTWEVRLRIAIEIAGALTYMHSAASFPIYHRDIKTTNILLDEKYGAKVSDFGTSRS--VTI 584

  Fly   376 DAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYV 440
            |.......|.||..|:.||:....|.:...||||||:||:|:.||.:...|: .:|..:.|..:.
plant   585 DQTHLTTMVAGTFGYMDPEYFLSSQYTDKSDVYSFGVVLVELITGEKPLSRI-RSEEGRGLATHF 648

  Fly   441 KQQWRQNR-MELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSM 488
            .:..::|| :::::..:...  .:||..|...:....|.:.....||:|
plant   649 LEAMKENRVIDIIDIRIKEE--SKLDQLMAVAKLARKCLSRKGIKRPNM 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 85/274 (31%)
TyrKc 219..495 CDD:197581 85/274 (31%)
WAKL5NP_173067.2 WAK 189..289 CDD:254827
PKc_like 438..705 CDD:419665 85/274 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.