DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and WAKL6

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_173062.1 Gene:WAKL6 / 838180 AraportID:AT1G16110 Length:642 Species:Arabidopsis thaliana


Alignment Length:247 Identity:83/247 - (33%)
Similarity:125/247 - (50%) Gaps:25/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQ-LDVAIKVMNYRSP 247
            ||:.:|.:         ....||:.|||.:|.:..|||||.|.||:|...: ..||:|    ||.
plant   412 GNVDMSRI---------FSSKELKKATDNFSMNRVLGQGGQGTVYKGMLAEGRIVAVK----RSK 463

  Fly   248 NIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPL 312
            .:.:.  ::::..||:..|:.|.|.||:.|.|..::...|.|||:.:..|.|..||......|..
plant   464 VVGEG--KMEEFINEVVLLSQINHRNIVKLLGCCLETEVPVLVYEYIPNGDLFKRLHEKSESNDY 526

  Fly   313 PALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVRE---GPKS 374
             .:||:.|..|::..|..:.::|:|...|:.|.|||..|||||:..:.|:.|||..|.   ....
plant   527 -TMTWEVRLRIAIEIAGALSYMHSAASIPIYHRDIKTTNILLDEKYRAKVSDFGTSRSITIAQTH 590

  Fly   375 LDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDR 426
            |..:|.     ||..|:.||:....|.:...||||||:||:|:.||.:...|
plant   591 LTTLVA-----GTFGYMDPEYFLSSQYTDKSDVYSFGVVLVELITGEKPLSR 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 74/212 (35%)
TyrKc 219..495 CDD:197581 74/212 (35%)
WAKL6NP_173062.1 GUB_WAK_bind 39..160 CDD:290658
WAK 189..293 CDD:254827
S_TKc 432..>634 CDD:214567 74/213 (35%)
PKc_like 438..>641 CDD:304357 74/212 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.