DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and PERK11

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_172532.1 Gene:PERK11 / 837605 AraportID:AT1G10620 Length:718 Species:Arabidopsis thaliana


Alignment Length:386 Identity:109/386 - (28%)
Similarity:173/386 - (44%) Gaps:67/386 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SSAKVNNGPPFPSSSGVSN----------SNNNRTSTTATEEIPSLESLGN-IHISTVQRAA--- 195
            ||.:.|...| |::..|:.          .|.|   ::|....|...|||| .|......:|   
plant   292 SSPRSNQYLP-PANVSVNTEGFIHYRQKPGNGN---SSAQNSSPDTNSLGNPKHGRGTPDSAVIG 352

  Fly   196 ESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRG-KWKQLDVAIKVMNYRSPNIDQKMVELQQS 259
            .|.:...|.||...|:|:.....:|:||||.||:| .::...||||.:...|          .:.
plant   353 TSKIHFTYEELSQITEGFCKSFVVGEGGFGCVYKGILFEGKPVAIKQLKSVS----------AEG 407

  Fly   260 YNELK----YLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQR 320
            |.|.|    .::.:.|.::::|.||.|......|:|:.:...:|:..|....    ||.|.|.:|
plant   408 YREFKAEVEIISRVHHRHLVSLVGYCISEQHRFLIYEFVPNNTLDYHLHGKN----LPVLEWSRR 468

  Fly   321 FSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVF 385
            ..|::|.|:|:.:||......:||.|||.:|||||...:.::.||||.|....:...:  ..:|.
plant   469 VRIAIGAAKGLAYLHEDCHPKIIHRDIKSSNILLDDEFEAQVADFGLARLNDTAQSHI--STRVM 531

  Fly   386 GTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRM- 449
            ||..||.||:.:..:|:...||:|||:||||:.|||:..|      |.:.|.:....:|.:.|: 
plant   532 GTFGYLAPEYASSGKLTDRSDVFSFGVVLLELITGRKPVD------TSQPLGEESLVEWARPRLI 590

  Fly   450 ELLEK--------------HLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            |.:||              ::.:.:.|       .||....|.......||.|..|::..:
plant   591 EAIEKGDISEVVDPRLENDYVESEVYK-------MIETAASCVRHSALKRPRMVQVVRALD 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 87/298 (29%)
TyrKc 219..495 CDD:197581 87/295 (29%)
PERK11NP_172532.1 Pkinase_Tyr 375..643 CDD:285015 87/296 (29%)
STKc_IRAK 376..644 CDD:270968 87/296 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.