DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT1G07870

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001184932.1 Gene:AT1G07870 / 837302 AraportID:AT1G07870 Length:538 Species:Arabidopsis thaliana


Alignment Length:350 Identity:112/350 - (32%)
Similarity:179/350 - (51%) Gaps:37/350 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PSSSGVSNS---NNNRTSTTATEEIPSLESLG-NIHISTVQRAAESLLEIDYAELENATDGWSPD 216
            |||.....|   :.|.......|:..||:..| |::.....:.|::   ..:.||..||..:..|
plant    45 PSSDSTKVSPYRDVNNEGGVGKEDQLSLDVKGLNLNDQVTGKKAQT---FTFQELAEATGNFRSD 106

  Fly   217 NRLGQGGFGDVYRGKWKQLD--VAIKVMNYRSPNIDQKMVE-LQQSYNELKYLNSIRHDNILALY 278
            ..||:||||.|::|..::||  ||||       .:|:..|: :::...|:..|:...|.|::.|.
plant   107 CFLGEGGFGKVFKGTIEKLDQVVAIK-------QLDRNGVQGIREFVVEVLTLSLADHPNLVKLI 164

  Fly   279 GYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLI 343
            |:..:|.:..|||:.|..||||..|  |...:....|.|..|..|:.|.|||:.:||.....|:|
plant   165 GFCAEGDQRLLVYEYMPQGSLEDHL--HVLPSGKKPLDWNTRMKIAAGAARGLEYLHDRMTPPVI 227

  Fly   344 HGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVY 408
            :.|:|.:||||.:..|||:.||||.:.|| |.|......:|.||..|..|::....||:...|:|
plant   228 YRDLKCSNILLGEDYQPKLSDFGLAKVGP-SGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIY 291

  Fly   409 SFGIVLLEVFTGRQVTDRVPENETKK--NLLDYVKQQW--RQNRMELLEKHLAA--PMGKELDMC 467
            |||:||||:.|||:..|   ..:|:|  ||:.:.:..:  |:|..::::..|..  |:.      
plant   292 SFGVVLLELITGRKAID---NTKTRKDQNLVGWARPLFKDRRNFPKMVDPLLQGQYPVR------ 347

  Fly   468 MCAIEAGLHCTALDPQDRPSMNAVL 492
              .:...|..:|:..|::|:|..|:
plant   348 --GLYQALAISAMCVQEQPTMRPVV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 96/282 (34%)
TyrKc 219..495 CDD:197581 96/282 (34%)
AT1G07870NP_001184932.1 STKc_IRAK 109..374 CDD:270968 96/282 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1620
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000861
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.