DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G65600

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_201363.1 Gene:AT5G65600 / 836686 AraportID:AT5G65600 Length:675 Species:Arabidopsis thaliana


Alignment Length:334 Identity:100/334 - (29%)
Similarity:165/334 - (49%) Gaps:37/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QRAAESLLEID-------------YAELENATDGWSPDNRLGQGGFGDVYRGKWKQLDVAIKVMN 243
            :|..|:::.|:             |.:|.:||:.:|...:||:||||.||.|..|:::..:.|..
plant   316 ERDIENMISINKDLEREAGPRKFSYKDLVSATNRFSSHRKLGEGGFGAVYEGNLKEINTMVAVKK 380

  Fly   244 YRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKA 308
            ....:...|    .:..||:|.::.:||.|::.|.|:..:..:..|:|:|:..|||.:.|...:.
plant   381 LSGDSRQGK----NEFLNEVKIISKLRHRNLVQLIGWCNEKNEFLLIYELVPNGSLNSHLFGKRP 441

  Fly   309 QNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPK 373
            .    .|:|..|:.|.||.|..:.:||......::|.|||.:||:||.....|:|||||.|....
plant   442 N----LLSWDIRYKIGLGLASALLYLHEEWDQCVLHRDIKASNIMLDSEFNVKLGDFGLARLMNH 502

  Fly   374 SLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRV------PENET 432
            .|.:  ....:.||..|:.||:......|...|:|||||||||:.|||:..:|.      .|::.
plant   503 ELGS--HTTGLAGTFGYMAPEYVMKGSASKESDIYSFGIVLLEIVTGRKSLERTQEDNSDTESDD 565

  Fly   433 KKNLLDYVKQQWR-QNRMELLEKHLAAPMGKELDM--CMCAIEAGLHCTALDPQDRPSMNAVLK- 493
            :|:|::.|   |. ..:.||:...:...:|::.|.  ..|.:..||.|...|...|||:...:: 
plant   566 EKSLVEKV---WELYGKQELITSCVDDKLGEDFDKKEAECLLVLGLWCAHPDKNSRPSIKQGIQV 627

  Fly   494 -RFEPFVTD 501
             .||..:.|
plant   628 MNFESPLPD 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 91/289 (31%)
TyrKc 219..495 CDD:197581 89/286 (31%)
AT5G65600NP_201363.1 lectin_legume_LecRK_Arcelin_ConA 36..263 CDD:173887
Pkinase 350..626 CDD:278497 90/288 (31%)
STKc_IRAK 356..629 CDD:270968 89/285 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.