DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G61570

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200965.2 Gene:AT5G61570 / 836278 AraportID:AT5G61570 Length:361 Species:Arabidopsis thaliana


Alignment Length:304 Identity:80/304 - (26%)
Similarity:147/304 - (48%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SPDNRLGQGGFGDVYRGKWKQLDVAIKVMNYRSP----NIDQKMVELQQSYN-ELKYLNSIRHDN 273
            :|...:|:..:|.:|:.. .|....::|:.:..|    |.|.|      .:| .::.|..:||||
plant    83 APGEVIGKSSYGTLYKAT-LQRSGKVRVLRFLRPLCAVNSDSK------EFNGVIESLGFVRHDN 140

  Fly   274 ILALYGYSI-KGGKPCLVYQLM-KGGSLEARLR--------AHKAQNPLPALTWQQRFSISLGTA 328
            ::.|.|:.: ..|:..:::... ..|:|.|.::        |||         |....||::|.|
plant   141 LVPLLGFYVGNRGEKLMIHPFFGSSGNLSAFIKFLAGGDVDAHK---------WSNILSITIGIA 196

  Fly   329 RGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPP 393
            :.:..|||....|::||::|..|:|||:..:|::.||||  ....:|.|..||.:....:.|..|
plant   197 KALDHLHTGMQKPIVHGNLKSKNVLLDKSFRPRVSDFGL--HLLLNLAAGQEVLEASAAEGYKAP 259

  Fly   394 EFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRM------ELL 452
            |....:::|...||||||:::||:.:|::.|::.|..    ::||       :||:      |::
plant   260 ELIKMKEVSKESDVYSFGVIMLELVSGKEPTNKNPTG----SVLD-------RNRLSDLYRPEII 313

  Fly   453 EKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            .:.|....|...:..:...:..:.|.:..|..|||...||::.|
plant   314 RRCLKDGNGVTEECVLEYFQLAMSCCSPSPTLRPSFKQVLRKLE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 79/299 (26%)
TyrKc 219..495 CDD:197581 78/296 (26%)
AT5G61570NP_200965.2 STYKc 85..356 CDD:214568 78/299 (26%)
STKc_IRAK 88..359 CDD:270968 79/299 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.