DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G61350

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200943.1 Gene:AT5G61350 / 836256 AraportID:AT5G61350 Length:842 Species:Arabidopsis thaliana


Alignment Length:303 Identity:106/303 - (34%)
Similarity:158/303 - (52%) Gaps:25/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 YAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD----VAIKVMNYRSPNIDQKMVELQQSYNEL 263
            :.||:.||..:..:...|.||||.||.|   ::|    ||||   ..|.:.:|.:.|.|   .|:
plant   515 FTELQTATQNFDENAVCGVGGFGKVYIG---EIDGGTQVAIK---RGSQSSEQGINEFQ---TEI 570

  Fly   264 KYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQ--NPLPALTWQQRFSISLG 326
            :.|:.:||.::::|.|:..:..:..|||:.|..|.|...|...|..  ||:|.|:|:||..|.:|
plant   571 QMLSKLRHRHLVSLIGFCDENKEMILVYEYMSNGPLRDHLYGSKENDPNPIPTLSWKQRLEICIG 635

  Fly   327 TARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVREGPKSLDAV-VEVNKVFGTKIY 390
            :|||:::|||.....:||.|:|..|||||:.|..|:.||||.::.|.....| ..|...||   |
plant   636 SARGLHYLHTGAAQGIIHRDVKTTNILLDENLVAKVSDFGLSKDAPMDEGHVSTAVKGSFG---Y 697

  Fly   391 LPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTD-RVPENETKKNLLDYVKQQWRQNRME-LLE 453
            |.||:...:||:...||||||:||.||...|.|.: ::|..:.  ||.:|.....|:..:| :::
plant   698 LDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPVINPQLPREQV--NLAEYAMNLHRKGMLEKIID 760

  Fly   454 KHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            ..:...:.|  ......:||...|.|....|||.|..||...|
plant   761 PKIVGTISK--GSLRKFVEAAEKCLAEYGVDRPGMGDVLWNLE 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 102/287 (36%)
TyrKc 219..495 CDD:197581 101/284 (36%)
AT5G61350NP_200943.1 Malectin_like 36..394 CDD:403886
STKc_IRAK 532..801 CDD:270968 101/284 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.