DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G59700

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200778.1 Gene:AT5G59700 / 836091 AraportID:AT5G59700 Length:829 Species:Arabidopsis thaliana


Alignment Length:344 Identity:116/344 - (33%)
Similarity:177/344 - (51%) Gaps:40/344 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SSSGVSNSNNNRTSTTATEEIPSLESLGNIHISTVQRAAESLLEIDYAELENATDGWSPDNRLGQ 221
            ||:|.::|:|..|             |.:|       |:.|...|....::.||:.:..:..:|.
plant   446 SSNGTTSSSNGTT-------------LASI-------ASNSSYRIPLVAVKEATNSFDENRAIGV 490

  Fly   222 GGFGDVYRGKWKQ-LDVAIKVMNYRSPNIDQKMVELQQSYNELKYLNSIRHDNILALYGYSIKGG 285
            ||||.||:|:... ..||:|..|   |...|.:.|.:   .|::.|:..||.::::|.||..:..
plant   491 GGFGKVYKGELHDGTKVAVKRAN---PKSQQGLAEFR---TEIEMLSQFRHRHLVSLIGYCDENN 549

  Fly   286 KPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQRFSISLGTARGIYFLHTARGTPLIHGDIKPA 350
            :..|||:.|:.|:    |::|...:.|.:|:|:||..|.:|:|||:::|||....|:||.|:|.|
plant   550 EMILVYEYMENGT----LKSHLYGSGLLSLSWKQRLEICIGSARGLHYLHTGDAKPVIHRDVKSA 610

  Fly   351 NILLDQCLQPKIGDFGLVREGPKSLDAVVEVNKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLL 415
            |||||:.|..|:.||||.:.||: :|.......|.|:..||.||:...:||:...||||||:|:.
plant   611 NILLDENLMAKVADFGLSKTGPE-IDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVMF 674

  Fly   416 EVFTGRQVTDRVPENETKKNLLDYVKQQWRQNRMELLEKHLAAP--MGK-ELDMCMCAIEAGLHC 477
            ||...|.|.|.....| ..||.::..:..::.::|    |:..|  .|| ..|......|.|..|
plant   675 EVLCARPVIDPTLTRE-MVNLAEWAMKWQKKGQLE----HIIDPSLRGKIRPDSLRKFGETGEKC 734

  Fly   478 TALDPQDRPSMNAVLKRFE 496
            .|....|||||..||...|
plant   735 LADYGVDRPSMGDVLWNLE 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021
STKc_IRAK 219..498 CDD:270968 103/282 (37%)
TyrKc 219..495 CDD:197581 102/279 (37%)
AT5G59700NP_200778.1 Malectin_like 33..378 CDD:289580
STKc_IRAK 488..753 CDD:270968 102/280 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.