DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pll and AT5G59660

DIOPT Version :9

Sequence 1:NP_001263008.1 Gene:pll / 43283 FlyBaseID:FBgn0010441 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001331675.1 Gene:AT5G59660 / 836087 AraportID:AT5G59660 Length:855 Species:Arabidopsis thaliana


Alignment Length:441 Identity:109/441 - (24%)
Similarity:177/441 - (40%) Gaps:103/441 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GRSASNEFLNIWGGQYNHTV-QTLFALFKKLKLH---NAMRLIKDYV----SEDLHKYIPRSVPT 135
            |...|..|:|:.|...:.:: |||..  |:|:|.   |....:.|..    .:.:|..|..||.:
plant   395 GNMKSLSFINLSGNNLSGSIPQTLQK--KRLELFVEGNPRLCLSDSCRKPPKKKIHVAIVASVAS 457

  Fly   136 IS----------ELRAAPDSSAKVNNGPPFPSSSGVSNSNNNRTSTTATEEIPSLESLGNIHIST 190
            .:          .||....:..:..:.||..|:..|:.:|......|..|.|....:...:    
plant   458 AAIVVAVLILFLILRKRKSTIVQGQHLPPSTSTVDVTFANKKSKRFTYLEVIKMTNNFQRV---- 518

  Fly   191 VQRAAESLLEIDYAELENATDGWSPDNRLGQGGFGDVYRGKWKQLD-VAIKVMNYRSPNIDQKMV 254
                                        ||:||||.||.|..|..| ||:||::..|        
plant   519 ----------------------------LGKGGFGMVYHGTVKGSDQVAVKVLSQSS-------- 547

  Fly   255 ELQQSYNELKYLNSIRHDNILALYGYSIKGGKPCLVYQLMKGGSLEARLRAHKAQNPLPALTWQQ 319
              .|.|.:.|                     ...|:|:.:..|.|:..|.....::   .:.|..
plant   548 --TQGYKQFK---------------------AEALIYEFLPNGDLKQHLSGKGGKS---IINWSI 586

  Fly   320 RFSISLGTARGIYFLHTARGTPLIHGDIKPANILLDQCLQPKIGDFGLVRE---GPKSLDAVVEV 381
            |..|:|..|.|:.:||.....|::|.|:|.||||||:..:.|:.||||.|.   ..:|.|:..  
plant   587 RLQIALNAALGLEYLHIGCIPPMVHRDVKTANILLDENFKAKLADFGLSRSFQVRGESYDSTF-- 649

  Fly   382 NKVFGTKIYLPPEFRNFRQLSTGVDVYSFGIVLLEVFTGRQVTDRVPENETKKNLLDYVKQQW-R 445
              |.||..||.||:....:|:...||||:||||||:.|.:.|...      |.::.::|..:. |
plant   650 --VAGTPGYLDPEYYPTSRLAAKSDVYSYGIVLLEMITNQPVISE------KYHITEWVGSKLNR 706

  Fly   446 QNRMELLEKHLAAPMGKELDMCMCAIEAGLHCTALDPQDRPSMNAVLKRFE 496
            .:.:|:::.:|....  :.:....|:|..:.|.......||:|:.|:...:
plant   707 GDIIEIMDPNLGGVY--DSNSAWRALELAMSCADPSSSKRPTMSQVINELK 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pllNP_001263008.1 Death_Pelle 32..128 CDD:260021 14/56 (25%)
STKc_IRAK 219..498 CDD:270968 82/283 (29%)
TyrKc 219..495 CDD:197581 82/280 (29%)
AT5G59660NP_001331675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.